Streptococcus troglodytae: SRT_00250 Help Entry SRT_00250         CDS       T06912                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism strg  Streptococcus troglodytae Pathway strg01100   Metabolic pathways strg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:strg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SRT_00250 (acpP)    00074 Mycolic acid biosynthesis     SRT_00250 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SRT_00250 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  BAQ23286 UniProt:  A0A1L7LGK6 LinkDB All DBs Position 32716..32964 Genome browser AA seq 82 aa AA seqDB search MTNEKIFDRISNLIKEQLHNEKIEVTMKTNIQEDLGIDSIALMEFIITLEDEFNLNIPDE DVEDIQTMGELVDYLSRRLKRS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactaatgaaaagatttttgacaggatttctaatcttattaaagaacagctgcacaat gaaaaaatagaagttacgatgaagaccaatattcaagaggacttaggaattgattccatt gcacttatggagtttatcattacgcttgaagatgaatttaatctgaacattcctgatgaa gatgtggaagatattcagaccatgggagaattggtcgactatctttcaaggcgtttaaag cgttcttag

DBGET integrated database retrieval system