Salmo trutta (river trout): 115183765 Help Entry 115183765         CDS       T08542                                  Name (RefSeq) fibroblast growth factor 16-like   KO K04358   fibroblast growth factor Organism stru  Salmo trutta (river trout) Pathway stru04010   MAPK signaling pathway stru04020   Calcium signaling pathway stru04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:stru00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115183765    04020 Calcium signaling pathway     115183765  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     115183765  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:stru04052]     115183765    00536 Glycosaminoglycan binding proteins [BR:stru00536]     115183765 Cytokines and neuropeptides [BR:stru04052]  Cytokines   Growth factors (RTK binding)    115183765 Glycosaminoglycan binding proteins [BR:stru00536]  Heparan sulfate / Heparin   Growth factors/receptors    115183765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  115183765 NCBI-ProteinID:  XP_029600715 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MMEVGGFLGTLDLDLQSFPALGSMPLAEAPAGLLDESLGQIEGRLQRGSLTDFGHLKGIL RRRQLYCRTGFQLEIFPNGTVYGTRQDHSRFGILEFISLAVGLVSIRGVDAGLYLGMNER GELYGSVS NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgatggaggttgggggctttctagggacactagacttggatttacagagtttccccgca ctaggaagtatgcccttggcagaggcgccagcggggttactggatgagagcctgggacag atcgaggggaggttacagcggggctcgctgacagatttcgggcaccttaaagggattctg cggcggaggcagctgtactgtagaaccggcttccagctggagatattccccaacgggact gtgtacgggacaagacaggaccacagcagatttggtatcctagagttcatcagtctggct gtagggctggtcagtattagaggagtggacgcaggactctacctgggcatgaacgagaga ggagagctctatgggtcggtaagttaa

DBGET integrated database retrieval system