Streptomyces sp. Sge12: B6R96_13800 Help Entry B6R96_13800       CDS       T11356                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism stsg  Streptomyces sp. Sge12 Pathway stsg00074   Mycolic acid biosynthesis stsg00280   Valine, leucine and isoleucine degradation stsg00630   Glyoxylate and dicarboxylate metabolism stsg00640   Propanoate metabolism stsg01100   Metabolic pathways stsg01110   Biosynthesis of secondary metabolites stsg01120   Microbial metabolism in diverse environments stsg01200   Carbon metabolism Module stsg_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:stsg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     B6R96_13800    00640 Propanoate metabolism     B6R96_13800   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     B6R96_13800   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     B6R96_13800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ARE74893 LinkDB All DBs Position 3168936..3169145 Genome browser AA seq 69 aa AA seqDB search MVIKVVKGNPTPEELAAALAVVQARAAVLAMAPSGAPPVADEWSTPARVARRRVPHPGPR AWGRTYWPA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt gtggtgatcaaggtcgtcaagggcaacccgaccccggaggagctggccgccgctctggcg gtggtccaggcgcgcgcggcggtgctggccatggcaccgtcgggcgctccgccggtcgcg gacgagtggtcgacgccggcccgcgtggcccggcggcgggtgccgcacccggggccgcgg gcctggggacgtacgtactggcccgcgtag

DBGET integrated database retrieval system