KEGG   Streptomyces qaidamensis: A4E84_25885
Entry
A4E84_25885       CDS       T04777                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi01057  Biosynthesis of type II polyketide products
stsi01100  Metabolic pathways
stsi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    A4E84_25885
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:stsi01008]
    A4E84_25885
Polyketide biosynthesis proteins [BR:stsi01008]
 Polyketide tailoring proteins
  Others
   A4E84_25885
SSDB
Other DBs
NCBI-ProteinID: AMW12612
UniProt: A0A143C5A5
LinkDB
Position
5801848..5802876
AA seq 342 aa
MPAVRDSARAITVLTLVCCSVFAAQTAFANRDKYGNNGDNQQSADAGKDGTVSVTVGGVV
FDRSKNGSGNAAGALTSTTSWSPPPCWYAPKYTPEQLKKYLEPTWEAGSTGYEWDAKQRD
RYVNGHPYKDFNKDKTGKGYFWDSFVNKDFPPGWDSCEKPIFWVDQGDPPPANIENAVTP
EVLAELAYAEVRVPSTKVTLAPAAQTKVNLPTWAWLDAADFKPVSVTASVPVIGIAATAT
AVPTSLRIEPGTKDAVTYPASGVCAINDGRIGEPYAKGKANRTPPCGVRYLRSSGDGTYP
LQATVTWKITWTGTGGTGGDLPDGTFGATQDVVVQEIQAVNR
NT seq 1029 nt   +upstreamnt  +downstreamnt
gtgccagccgtaagagactcggcgagagccataacggtcctgactctggtttgttgctct
gtcttcgctgcccagacggccttcgccaatcgcgacaagtacgggaacaacggagacaac
cagcagagcgctgatgcaggcaaggacggcaccgtctccgtcaccgttggcggcgtcgtc
ttcgaccgttcgaagaacggcagcggaaacgccgcgggcgcgctcacgtcgaccacgtca
tggtccccgcccccctgctggtacgccccgaagtacacgccggaacagctgaagaagtac
cttgagccgacgtgggaggccggttcgacgggctatgagtgggacgccaaacagcgggac
cgctacgtcaacgggcacccctacaaggacttcaacaaggacaagaccggcaagggatac
ttctgggattccttcgtcaacaaggatttccccccgggctgggactcctgtgagaagccc
atcttctgggtggaccagggcgaccccccgccggcgaacatcgagaacgctgtcactccg
gaggtcctggccgaactcgcctacgccgaggtccgagtccccagcaccaaggtgaccctt
gcgcccgccgcacagaccaaggtcaacctgccgacctgggcctggctggacgccgccgac
ttcaagccggtctccgtcaccgcgtccgtacccgtgatcggcatcgccgcgaccgcgacc
gcggtacccacgtccctccgcatagagcccggcaccaaggacgccgtcacctacccggcc
tccggcgtctgcgcgatcaacgacggccgcatcggcgagccctacgccaagggcaaggcg
aaccgcactccaccttgcggagtgagatacctgcgctcctcgggagacggcacatacccg
ctccaggcgaccgtgacctggaagatcacgtggaccggcacgggcggcacaggcggcgac
ctccccgacggcacgttcggcgccacccaggatgtggtcgtacaggagatccaggccgtc
aaccgctga

DBGET integrated database retrieval system