Streptomyces tubercidicus: STRTU_002179 Help Entry STRTU_002179      CDS       T09099                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism stud  Streptomyces tubercidicus Pathway stud00190   Oxidative phosphorylation stud01100   Metabolic pathways Module stud_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:stud00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     STRTU_002179 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:stud00194]     STRTU_002179 (atpE) Photosynthesis proteins [BR:stud00194]  Photosystem and electron transport system   F-type ATPase [OT]    STRTU_002179 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WAU11907 LinkDB All DBs Position complement(2587649..2587897) Genome browser AA seq 82 aa AA seqDB search MSAALETVNLAAGVTGNLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRTNQI MGFAFCEALALIGIVMGFLFKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgctctcgagactgtcaacctcgccgccggcgtcaccggcaacctcggttcg atcggttacggcctcgccgcgatcggccccggcgtcggcgtcggcatcatcttcggtaac ggcacccaggccctggcccgccagcccgaggccgccggcctgatccgcaccaaccagatc atgggtttcgccttctgtgaggcgctcgccctgatcggcatcgtcatgggcttcctcttc aaggcctga

DBGET integrated database retrieval system