KEGG   Sulfurospirillum sp. ACSTCE: FA592_13750
Entry
FA592_13750       CDS       T06548                                 

Definition
(GenBank) reductive dehalogenase
  KO
K21647  tetrachloroethene reductive dehalogenase [EC:1.21.99.5]
Organism
sult  Sulfurospirillum sp. ACSTCE
Pathway
sult00625  Chloroalkane and chloroalkene degradation
sult01100  Metabolic pathways
sult01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sult00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FA592_13750
Enzymes [BR:sult01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.5  tetrachloroethene reductive dehalogenase
     FA592_13750
SSDB
Motif
Pfam: Dehalogenase Fer4_16 Fer4_7 Fer4_10 Fer4_6 Fer4 Fer4_9 Fer4_2
Other DBs
NCBI-ProteinID: QIR79854
UniProt: A0A6G9VY46
LinkDB
Position
2678386..2679888
AA seq 500 aa
MEKKKKPELSRRDFGKLIIGAGAAATIAPFGVPGANAAEKEKNAAEIRQQFAMTAGSPII
VNDKLERYAEVRTAFTHPTSKFKPNYKGEVKPWFLSDFDNKVRQIENGENGPKMKAKNVG
EARAGRALEAAGFTLDNNFGGTFGGYPNRFSMLWSGETMLNTRMWAPVGLDRRPPDTTDP
VELTNYVKFAARMAGADLVGVARLNRNWVYSEAVTIPDEQSWPKEIEKPIVFKDVPLPIE
TDDELIIPNTCENVIVAGIAMNREMMQTAPNSMSCAAAAFGYSRMCIFDMWLCQFIRYMG
YYAIPCSNTLGQSVPFAVEAGLGQASRMGLCITPEFGPNVRLTKVFTNMPLVPDKPIDFG
VTEFCETCKKCARECPSKAISEGPRTFEGRSIHNQSGKLQWQNDHSKCLGYWVESGGYCG
MCVAVCPFTKGNIWIHDGVEWLIDNIRFLDPLMLGMDDALGYGAKRNITEVWDGKINTYG
LDADHFRDAVSFRKDRVKKS
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggaaaagaaaaaaaagcctgaactctcaagaagagattttggtaagttgattatcgga
gctggagctgcagcaacgatagctccatttggtgtaccaggtgcaaatgcagctgaaaaa
gagaaaaatgcagctgaaattcgtcaacaatttgcaatgactgcaggttctcccatcata
gttaacgacaaattggaaagatatgctgaagtacgaacagcgtttactcatccaacctca
aagtttaaaccaaactacaaaggtgaagtgaaaccttggtttttatcagattttgataac
aaagtacgtcagattgaaaatggtgaaaatggtcctaagatgaaagctaaaaatgtagga
gaagctagagcaggtcgtgcacttgaagctgctggatttaccttagataataactttgga
ggtacctttggaggttatccaaatagattttctatgttatggtctggtgagactatgctt
aacacccgaatgtgggcaccagtagggttagatagaagacctccagatacaactgatcct
gtggaacttacaaattatgtaaaatttgctgcacgtatggcaggtgctgatttggtaggt
gttgcaagattaaatcgtaactgggtttattctgaggcagtaactataccagatgaacaa
tcttggcctaaagagattgaaaagccaatcgttttcaaagatgttccactaccaatagaa
actgatgatgaattaattatccctaatacttgtgaaaatgttatcgttgcaggtatcgct
atgaaccgcgaaatgatgcaaacagctcctaacagtatgtcatgtgcagcagcagcattt
ggttattcacgtatgtgtatattcgatatgtggttatgccagtttattcgttatatgggt
tactatgcaattccatgcagtaatactcttggacaatcagttccctttgctgttgaagca
ggtttaggacaagctagtcgtatgggtctttgtattactcctgaatttggaccaaacgta
agacttacaaaagtctttacaaatatgcctttagttccagataagcctatcgactttgga
gtaacagaattttgtgaaacatgtaaaaaatgtgcacgtgagtgtccttcaaaagcaatt
tctgaaggtccaagaacttttgaaggacgaagtattcataatcaatcaggtaaattacag
tggcaaaatgaccatagtaaatgcttaggttattgggtggaatctggtggatattgtggt
atgtgtgtagctgtttgcccctttacaaaaggcaatatttggattcatgatggcgttgaa
tggcttattgataacataagattcttagacccattaatgcttggtatggatgatgcattg
ggctatggtgcaaaacgaaatattacagaagtttgggatggaaagattaatacatatggt
ctagacgcagaccattttagagacgctgtaagctttagaaaggatagggttaaaaaatca
tga

DBGET integrated database retrieval system