KEGG   Sceloporus undulatus (fence lizard): 121936374
Entry
121936374         CDS       T07740                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
sund  Sceloporus undulatus (fence lizard)
Pathway
sund04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sund00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    121936374 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sund04050]
    121936374 (TNFRSF8)
   04090 CD molecules [BR:sund04090]
    121936374 (TNFRSF8)
Cytokine receptors [BR:sund04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   121936374 (TNFRSF8)
CD molecules [BR:sund04090]
 Proteins
  121936374 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 DUF3974
Other DBs
NCBI-GeneID: 121936374
NCBI-ProteinID: XP_042334515
LinkDB
Position
7:complement(1649245..1658008)
AA seq 496 aa
MGLCRVSAPCSALLFLAFLHLRIQAKPSSQKQPLLFIRILQDFGFVAVFSTHDFGAFLTL
QGCANLAHKEALRRCCLQCPPGYRPKTACPLDLDRDCAKIPCEPEYYLNQQLVRPRCEAC
VKCTTERHLLERSACTQDTGRVCECESGRFCQTPVANSCARCTPHRSCKPGFGVRTKGTA
ENDTECEECPPGTFSNEDSSIQPCNTHTNCTRLNKISVRKGNATHDERCANQPSVNIAGI
SLGTSPLESLGNIIKEAVDTLDSGHLFGDGATTVRKPTDALNASLFDITIEKTWRRGEHD
FTLLGVLFLLGLMLCACAVMLWRRRACHKWTVPYKVKLSKRAKICAKQMNMLSSAENHQR
ERETMNIQLLTEECNGSSLLEMEEPLELDPVGTDPVQADGGVSGESPPQCTNCIEKIYIM
RADTVIVGSVSEVPSGKNCAVRDEDGSSGMQKDVEEKEVTIHFPEQETELCLGSDITTPV
EEEWEFHYSAEETLVI
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggggctctgcagggtctctgccccttgctctgccctcctcttcctggcatttctccat
ctgaggatccaggccaagccttcctcccagaaacagccgctgcttttcatacgcattttg
caggattttggtttcgttgctgttttttcaacccatgactttggtgcttttctgacatta
cagggatgtgcaaatctcgcccacaaggaagccctccggagatgttgcctccagtgccct
ccaggttaccgcccaaagaccgcatgtcccttggatttggacagagactgcgcaaagata
ccttgtgagccggaatattacctgaaccagcaacttgtgaggccacggtgtgaggcgtgc
gtgaaatgcacaaccgagcggcacttgctggaaagatctgcttgcacccaggacaccggc
cgggtttgcgagtgcgaatctggacggttttgccaaacgccggtggcgaactcatgcgcc
cggtgcacgccccatcgctcctgcaaaccgggctttggggtcaggactaaagggacggcg
gagaatgacaccgagtgcgaggaatgccctccagggacattctccaacgaggattcgagc
atccaaccctgcaatacccacaccaactgtacaagactaaacaagatttctgttcgcaaa
ggaaacgccactcatgatgaacggtgcgccaaccagccgtctgtgaacatagcgggcatt
tccttgggcacttcacctcttgaatcccttggcaatataatcaaggaagctgtggacacg
ctggactccggacacttgtttggcgatggcgccacgaccgttaggaaaccgacagatgca
ctgaacgccagccttttcgacataaccatagagaagacttggagaagaggtgagcacgat
ttcaccctcctgggagtcctcttccttttgggactgatgctttgcgcctgtgcggtgatg
ctctggcgaaggagagcttgccacaagtggactgtcccctacaaagtgaaattatctaag
agggcaaagatatgtgcgaagcagatgaatatgctgagctctgcagagaaccatcagaga
gaaagagaaacaatgaatatccagcttctcacagaagaatgcaatggcagttcactctta
gaaatggaggaacccctcgaactcgatcctgtaggaaccgacccggtccaggcggatgga
ggagtatcgggagagtctcctccgcaatgcacaaattgcatcgaaaaaatatacatcatg
agagcggacacggtgatcgtcgggtccgtttcggaagtgccttctgggaagaattgcgcc
gtgagagatgaagacggaagctctgggatgcaaaaagatgtagaggagaaggaagtgacc
atacacttcccagaacaggaaacggaattgtgtctgggaagtgacatcacaacgccggtg
gaggaagaatgggaattccactactctgcggaggagactttggtcatctag

DBGET integrated database retrieval system