KEGG   Serratia ureilytica: J0X03_00075
Entry
J0X03_00075       CDS       T07185                                 
Symbol
recG
Name
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:5.6.2.4]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_00075 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_00075 (recG)
Enzymes [BR:suri01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     J0X03_00075 (recG)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     J0X03_00075 (recG)
SSDB
Motif
Pfam: RecG_wedge Helicase_C DEAD ResIII RecG_dom3_C tRNA_anti-codon SecA_DEAD AAA_30 SNF2-rel_dom DUF2075 Helicase_RecD ERCC3_RAD25_C DNA_pol_lambd_f HHH_5 Cdd1 IMS_HHH
Other DBs
NCBI-ProteinID: QSR07435
LinkDB
Position
complement(16255..18336)
AA seq 693 aa
MKGRLLDAVPLTTLSGVGASQAGKLAKLGLDTIQDLLLHLPLRYEDRTRLYPINDLLPGI
YATVEGEVLRSDISFGRRRMLTCQISDGTGILTMRFFNFNAAMKNSLATGRRVTAYGEIK
RGNHGAEIIHPEYRIQGETSEVELQESLTPVYPTTEGVRQATLRKLTDQALELLDTCAIA
ELLPPELSGGLMSLPQALHTLHRPPPDIQLADLELGKHPAQKRLILEELLAHNLSMLAVR
AGAQSYQAQPLLPDDRLKNRFLAQLPFSPTGAQTRVVADIEADMQKDFPMMRLVQGDVGS
GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRQWFEPLGLEVGWLAGKQKGKAR
IAQQEAIASGQVSMVVGTHAIFQEQVQFNGLALVIIDEQHRFGVHQRLALWEKGEEQGFH
AHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPVTTVAIPDTRRADIIQRVKSACL
EEGRQAYWVCTLIEESELLEAQAAEATWEELKTALPELKIALVHGRMKAQEKQAVMQAFK
QGELQLLVATTVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKT
PLSKTAQTRLQVLRDSNDGFVIAQRDLEIRGPGELLGTRQTGSAEFKVADLLRDQAMIPE
VQRVARHLHQHYPEHAQALIERWLPEKARYSNA
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaaaggccgcctgctggatgctgtcccactcaccacgctttccggggttggcgccagc
caggcgggcaaactggccaagcttggcctcgacaccattcaggatctgctgctgcacctg
ccgctgcgctacgaagaccgcacccgcctctacccgatcaacgatctgctgccaggcatc
tacgccacggtagaaggggaagtgctgcgcagcgacatcagcttcggccgccgccgcatg
ctgacctgccagatcagcgacggcaccggcatcctcaccatgcggttcttcaacttcaac
gccgcaatgaagaacagcctggccaccggccgccgcgtgaccgcctacggcgagatcaaa
cgcggcaaccacggcgcggagatcatccatccggagtaccgtattcagggcgaaaccagc
gaggttgagctgcaggagtcgctgacgccggtctaccccaccaccgagggggtgcggcag
gccacgctgcgcaagctgaccgaccaggcgctggagctgctggatacctgcgccatcgcc
gaactgctgccgccggagctgagcggcggcctgatgagcctgccgcaggcgctgcacacc
ctgcatcgcccgccgccggacatccagctggcggatctggagctgggcaaacacccggcg
caaaagcgtctgatcctcgaagagctgctggcgcataacctcagcatgctggcggtgcgt
gccggcgcgcagagttatcaggcgcagccgctgctgccggacgatcggctgaaaaaccgt
tttctcgcccagttgccgttctcgccaaccggcgcgcaaacgcgcgtggtggccgacatc
gaagccgatatgcaaaaagacttcccgatgatgcggctggtgcagggcgacgtcggctcc
ggcaaaacgctggtggcggcgctggcggcgctgcgcgccatcgcgcacggcaagcaggtg
gcgctgatggcgccgaccgagctgctggccgaacagcatgccaacaacttccgccagtgg
ttcgagccgctggggctggaggtcggctggctggcgggcaaacagaaaggcaaggcgcgc
atcgcgcagcaggaagccatcgccagcggccaggtgtcgatggtggtcggcacccacgcc
atcttccaggagcaggttcagttcaacggcctggcgctggtgatcattgatgagcagcac
cgcttcggggtgcatcagcggctggcgctgtgggagaaaggcgaagagcaaggtttccac
gcccatcagctgatcatgaccgccacgccgatcccgcgcacgctggcaatgaccgcctac
gccgatctcgatacctcggtcatcgacgagctgccgccgggccgtacgccggtgaccacc
gtggccattcccgatacccgccgcgccgacatcattcaacgggtgaaaagcgcctgtctg
gaagaggggcggcaggcttactgggtgtgcacgctgatcgaagagtccgaactgctggaa
gcgcaggcggcggaagccacctgggaagaattgaaaaccgcgctgccggagctgaagata
gcgctggtacatggccgcatgaaagcgcaggaaaagcaggcggtgatgcaggcgtttaaa
cagggcgagctgcagctgttggtcgccaccacggtgatcgaagtcggtgtcgacgtgccg
aacgccagcctgatgatcatcgaaaacccggagcggctgggcctggcgcagctgcaccag
ctgcgcggccgcgtagggcgcggcgcggtggcttcacactgcgtgctgctgtacaaaacg
ccgctgagcaaaaccgcgcaaacgcgcctgcaggtgctgcgcgacagcaacgacggcttc
gtcatcgcgcagcgcgatctggagatccgcggcccgggcgagctgctgggcacccgccag
accggcagcgccgaattcaaggtggcggacctgttgcgcgaccaggcgatgatccccgaa
gtgcagcgcgtcgctcgccatctccatcagcactacccggaacacgcccaggcgctgatc
gaacgctggttgccggagaaggcgcgctactccaacgcataa

DBGET integrated database retrieval system