KEGG   Serratia ureilytica: J0X03_00165
Entry
J0X03_00165       CDS       T07185                                 
Symbol
mutM
Name
(GenBank) bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_00165 (mutM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_00165 (mutM)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     J0X03_00165 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     J0X03_00165 (mutM)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_00165 (mutM)
SSDB
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS zf-dskA_traR
Other DBs
NCBI-ProteinID: QSR07451
LinkDB
Position
32277..33092
AA seq 271 aa
MPELPEVETSRRGIEPYLVGHSIQYAVVRNARLRWPVSEQILTLSDQPVLSVQRRAKYLL
IELERGWIIVHLGMSGSLRMLREENEDEAGKHDHVDLVINNGMILRYTDPRRFGAWLWCE
DLATSSVLSHLGPEPLSEAFNGDYLYEKSRNKRTLIKPWLMDNKLVVGVGNIYASESLFS
AGILPDRPAGSLTKAEAALLAKTIKAVLQRSIEQGGTTLRDFLQSDGKPGYFAQELQVYG
RAGEPCRTCGTPIESAKHGQRSTFFCRRCQR
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcctgaattaccggaagttgagacgagcagacgcggtatagagccttatcttgtcggc
cacagcattcagtatgcggtggtgcgcaacgcgcgcctgcgctggccggtttccgagcag
atcctgacgttgagcgatcagccggtgctcagcgtgcagcgtcgggccaaatacctgctg
attgagctggagcgcggttggattatcgtgcatctgggcatgtcgggcagcctgcgcatg
ctgcgtgaggaaaacgaagacgaagccggcaaacacgaccacgtcgatctggtgatcaac
aacggtatgatcctgcgctataccgatccgcgccgcttcggcgcctggctgtggtgcgaa
gacctggcgaccagcagcgtgttgtcgcatctggggccggaaccgctgagtgaggcgttc
aacggcgactacctgtatgaaaaatcacgtaataagcgcacgctgatcaaaccgtggctg
atggataataagctggtggtcggggtcggtaacatttacgccagtgaatcgctgttcagc
gccgggatcctgcccgatcgtccggcgggatccttgaccaaagccgaagcggcgctgttg
gcgaagaccatcaaggcggtgttgcaacgctccatcgagcagggcggcaccacattgcgc
gactttttgcagtcggacggcaaaccggggtacttcgcgcaggagctgcaggtttacggg
cgggcgggagaaccgtgccgcacatgcggcacgccgattgaatccgccaagcacgggcag
cgcagcaccttcttttgccgacgctgccagcgctga

DBGET integrated database retrieval system