KEGG   Serratia ureilytica: J0X03_00420
Entry
J0X03_00420       CDS       T07185                                 
Symbol
priA
Name
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:5.6.2.4]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_00420 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_00420 (priA)
Enzymes [BR:suri01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     J0X03_00420 (priA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_00420 (priA)
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD ResIII Helicase_C PriA_CRR AAA_30 zinc-ribbons_6 TrwB_AAD_bind Zeta_toxin zf-H2C2_5 AAA_22 AAA_19
Other DBs
NCBI-ProteinID: QSR07500
LinkDB
Position
complement(82412..84607)
AA seq 731 aa
MPVVHVALPVPLARTFDYLLPSGMQPVAGARVGVPWGRQHAIGIVTGCSDTSELPLDKLK
PIDSVIDTESLFSPSLWRILRWASDYYHYPIGEVLFHALPILLRQGKPAEAAPLWQWFAT
EEGRATPPESLKRAPKQQQALAALLQRPVYRHQVSQLELTESALQALRAKGLIDLRAQVA
ATQDWRPNFAVLGERLRLNTEQATAVGAIRSEDEQFAAWLLAGVTGSGKTEVYLSVLENV
LAKGRQALVLVPEIGLTPQTIARFRERFNAPVDVLHSGLNDSERLAVWLRARSGEAAIVI
GTRSALFTPFRQLGVIIIDEEHDSSYKQQEGWRYHARDLAVFRAREEDIPIVMGSATPAL
ETLHNVQLGKYRQLKLTQRAGNAKPAAQHLIDLKGLPLKVGLSQPLLKSMQHHLKAGNQV
MLFLNRRGYAPALLCHECGWIAECQRCDHYYTFHQHQRQLRCHHCDSQRPVPHQCPQCGS
THLVSVGVGTEQLEHELAPLFPDTPITRIDRDTTSRKGSLEQHLADIHRGEARILIGTQM
LAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVLLQTHHP
EHPLLQVLLQQGYDAFAKQTLAERNSVFLPPYTSHIIVRAEDHDNQQAPLFLQQLRNLLE
ASPLKDDSLWVMGPVPALQSKRGGRFRWQLLLQHPTRRVLQQLMKSSLPLIGTLPQTRKV
KWTLDVDPIDS
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgcccgtcgtacacgttgctttgccggtccccctcgcccgcaccttcgactatctgctg
ccgtccggcatgcagccggtggccggcgcgcgcgtgggcgtgccctggggcaggcagcat
gcaatcggcatcgtcaccggctgcagcgacaccagcgaactgccgttggacaagctcaaa
ccgatcgacagcgtgatcgacacggaatcgctgttctcccccagcctgtggcgcatcctg
cgctgggccagcgattactaccactatcccatcggcgaagtgctgttccacgcgctgccg
atcctgctgcgccaaggcaaaccggccgaggccgcgccgctgtggcagtggttcgccacc
gaagaggggcgcgccacgccgcccgaaagcctgaaacgcgcgccgaaacagcagcaggcg
ctggcggcgctgttgcaacgcccggtctatcgccatcaggtcagccagcttgagctgacg
gaaagcgccctgcaggcgctgcgcgccaaagggctgatcgatctgcgcgctcaggtcgcg
gccacgcaggactggcgccccaactttgcggtgctcggcgagcggctgcggctgaatacc
gaacaggccaccgccgtcggggcgatccgaagcgaagatgagcagtttgccgcctggctg
ctggccggggtcaccggctccggcaagaccgaggtgtatctcagcgtgctggaaaacgtg
ttggccaaaggccggcaggcgctggtgctggtgccggaaatcggcctgacgccgcaaacc
atcgcccgctttcgcgagcgcttcaacgcgccggtggacgtgctgcactccgggctgaac
gacagcgaacggctggcggtttggctgcgcgcgcgcagcggcgaagccgctatcgtcatc
ggcacccgctcggcgctgttcacgccgttccggcaactgggcgttatcatcatcgacgaa
gagcacgacagctcttataaacagcaggaaggctggcgctaccacgcccgcgatctggcg
gtgttccgcgcccgggaagaagatatcccgatagtgatgggctccgccacgccggcactg
gaaacactgcacaacgtgcagctgggcaaatatcgccagttgaagctcacccagcgcgcg
ggcaacgccaaaccggcggcgcagcatctgatcgatctgaaagggttgccgctgaaggtc
ggcctgtcgcagccgcttttgaaaagcatgcagcaccatttaaaagccggcaatcaggtg
atgctgttcctcaaccgccgcggttacgccccggcgctgctgtgccacgagtgcggctgg
atcgccgagtgccagcgctgcgatcactattacaccttccaccagcatcagcgccagctg
cgctgtcaccactgcgacagccagcgaccggtgccgcaccaatgcccgcagtgcggctcc
acccacctggtatcggtcggcgtcggcaccgaacagctggaacatgagctggcgccgctg
ttccccgacacgccgatcacccgcatcgatcgcgacaccaccagccgcaaagggtcgctg
gagcagcatctggcggatattcatcgcggcgaagcgcgcattctgatcggcacgcaaatg
ctggccaagggccaccattttcccgacgtcacgctggtggcgttgctggacgtggacggc
gcgctgttctccgccgacttccgctccgccgagcgttttgctcagctctatacccaggtc
tccgggcgcgcggggcgagcgggcaaacagggtgaagtgctgctgcaaacccaccacccg
gagcacccgttattgcaggtgctgctgcaacaaggttacgacgccttcgccaaacagacg
ctagcggagcgcaacagcgtgtttctaccgccctacaccagccacatcatcgtgcgcgcc
gaagatcacgataaccaacaggccccgctgttcctgcagcagctgcgcaatctgttggaa
gccagtccgcttaaggacgattcgctgtgggtgatgggcccggtgccggcgctgcagtcc
aaacgcggcggccgtttccgctggcagctgctgctgcagcatccgacacggcgcgtcctg
caacagctgatgaaaagctcgctgccgctgatcggcaccctgccgcaaacgcgcaaggtg
aaatggacgctggatgtcgatccgatcgacagctga

DBGET integrated database retrieval system