KEGG   Serratia ureilytica: J0X03_02085
Entry
J0X03_02085       CDS       T07185                                 
Symbol
ssb1
Name
(GenBank) single-stranded DNA-binding protein SSB1
  KO
K03111  single-strand DNA-binding protein
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_02085 (ssb1)
   03430 Mismatch repair
    J0X03_02085 (ssb1)
   03440 Homologous recombination
    J0X03_02085 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_02085 (ssb1)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_02085 (ssb1)
   03029 Mitochondrial biogenesis [BR:suri03029]
    J0X03_02085 (ssb1)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    J0X03_02085 (ssb1)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     J0X03_02085 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    J0X03_02085 (ssb1)
Mitochondrial biogenesis [BR:suri03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    J0X03_02085 (ssb1)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: QSR07804
LinkDB
Position
441678..442208
AA seq 176 aa
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEQKEKTEWHRVVL
FGKLAEVAGEYLRKGSQVYIEGSLQTRKWQDQSGQDRYTTEIVVNVGGTMQMLGGRQGGG
APAGQSAGGQGGWGQPQQPQGGNQFSGGQQQSRPAQNSAPATSNEPPMDFDDDIPF
NT seq 531 nt   +upstreamnt  +downstreamnt
atggccagcagaggcgtaaacaaagtaattctggtcgggaatctgggtcaggatccagaa
gtccgttacatgccgaacggcggcgcagtggccaacattaccctggcgacctccgaaagc
tggcgtgacaaagcgaccggcgaacagaaagagaagaccgagtggcaccgcgttgtgctg
ttcggcaaactggctgaagtggcgggcgaatacctgcgcaaaggctctcaggtctatatc
gaaggctccctgcagacccgtaaatggcaggatcagagcggccaggatcgctacaccacc
gagatcgtggttaacgtcggcggcaccatgcagatgttgggcggccgtcagggcggcggc
gcaccggccggtcaatctgccggcggccagggcggttggggccagcctcaacagccacag
ggcggcaaccagttcagcggcggccagcagcagtctcgtccggcgcagaacagcgctccg
gcgaccagcaacgaaccgccaatggatttcgacgacgatattccgttctaa

DBGET integrated database retrieval system