KEGG   Serratia ureilytica: J0X03_04250
Entry
J0X03_04250       CDS       T07185                                 
Symbol
mutH
Name
(GenBank) DNA mismatch repair endonuclease MutH
  KO
K03573  DNA mismatch repair protein MutH
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_04250 (mutH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04250 (mutH)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Strand discrimination factor
     J0X03_04250 (mutH)
SSDB
Motif
Pfam: MutH MvaI_BcnI
Other DBs
NCBI-ProteinID: QSR08209
LinkDB
Position
complement(921592..922278)
AA seq 228 aa
MAFLSPLPPPPENERQLFERAQALAGFSFGELAARAQLPIPKDLKRDKGWVGMLLELYLG
AMAGSKPEQDFPELGIELKTIPVDAAGKPLETTFVCVAPLTGNSGVTWASSHVRHKLARV
LWIPVEGERQIPLAQRRVGSPLLWSPSAAEEEMLRRDWEELMDLIVLGHVERITARHGEV
LQLRPKAANNKALTEAIGEQGQPIMTLPRGFYLKKGFTGALLARHFSI
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgtttttatcccctctgccacccccgccggaaaatgaacggcagctgttcgagcgc
gctcaggcgctggccggcttcagttttggcgaactggccgcccgcgcgcagttgccgatc
cccaaggatctgaaacgcgataaaggctgggtgggcatgctgctggagctgtacctcggt
gccatggccggcagcaaaccggaacaggattttcctgagctgggcattgagctgaaaacc
attcctgtcgacgccgccggcaaaccgctggagaccactttcgtctgcgtggccccgctc
accggcaacagcggcgtcacctgggccagcagccacgttcgccacaagctggcgcgcgtg
ttgtggataccggtagagggcgaacggcaaatcccgctggcgcagcgccgcgtcggttcg
ccgctgctgtggagcccgagcgctgcagaagaagagatgctgcgccgcgattgggaagag
ctgatggatctgattgtgctcggtcacgtagaacgcatcaccgcacgccacggcgaagtg
ctgcaactgcgccccaaagcggccaacaacaaggcgctcaccgaagccatcggcgaacag
gggcaacctatcatgacgctgccgcgcggtttctatctgaaaaagggttttaccggcgcg
ctgctggcaagacatttctcaatctaa

DBGET integrated database retrieval system