KEGG   Serratia ureilytica: J0X03_04525
Entry
J0X03_04525       CDS       T07185                                 
Symbol
dnaE
Name
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_04525 (dnaE)
   03430 Mismatch repair
    J0X03_04525 (dnaE)
   03440 Homologous recombination
    J0X03_04525 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_04525 (dnaE)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_04525 (dnaE)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_04525 (dnaE)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_04525 (dnaE)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_04525 (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: QSR08258
LinkDB
Position
988687..992175
AA seq 1162 aa
MAEPRFIHLRVHSDYSMIDGLAKTAPLVKRAAALAMPALAITDFTNLCGLVKFYGSAHGA
GIKPIIGADFHVQSEVLGDELAQLTVLASNNEGYQNLTLLISRAYQRGYGAAGPIIDRDW
LIEHREGLILLSGARQGDVGKFLLRGNQAQVDQCLDFYQQYFPDCYYLELIRTGRPDEEN
YLHAAVALATERGLPVVATNDVRFLVEDDFDAHEIRVAIHDGFTLDDPKRPRNYSPQQYM
RSEDEMCELFADIPEALLNSVEIAKRCNVTIRLGEYFLPQFPTGDMSTEDFLVLKSKEGL
EERLEFLFPDPDVRAQRRPEYDERLDVELKVINQMGFPGYFLIVMEFIQWSKDNNVPVGP
GRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMPDFDVDFCMEKRDQVIEHVAE
MYGREAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLEKAFAAEPQ
LPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVIAPTKITDFAPLYCDAEGNHPVTQ
FDKNDVEYAGLVKFDFLGLRTLTIIDWALEMINARRAKTGLEPIDIAAIPLDDKKSFDML
QRSETTAVFQLESRGMKDLIKRLKPDCFEDMIALVALFRPGPLQSGMVDNFIDRKHGREE
ISYPDIQWQHESLKPVLEPTYGIILYQEQVMQIAQVLAGYTLGGADMLRRAMGKKNPVEM
AKQRGGFEDGAKARGIDGELSVKIFDLVEKFAGYGFNKSHSAAYALVSYQTLWLKAHYPA
EFMAAVMTADMDNTDKVVGLVDECWRMGLKILPPDINSGLYHFHVNDDGEIVYGIGAIKG
VGEGPIEAIIEARNSGEQGYFKDLFDLCARSDIKKLNRRILEKLIMSGAFDRLGPHRAAL
MNSLGDALKAADQHAKAEAIGQVDMFGVLAEAPEQVEQSYANIAPWPEQVVLDGERETLG
LYLTGHPITQYLKEIERYAGGQRLKDMHPTDRGKMTTAVGLVVAARVMVTKRGNRIGICT
LDDRSGRLEVMLFTEALEKYQHLLEKDRILIASGQVSFDDFSGGLKMMAREVMDISEARE
KYARGLAISLTDRQIDDQLLNRLRQSLEPHRSGTIPVHLYYQREDARAKLRFGATWRVTP
TDRLLIDLRTLVGNEQVDLEFD
NT seq 3489 nt   +upstreamnt  +downstreamnt
atggccgaacctcgttttattcacctgcgcgtccacagtgactactccatgattgatgga
ttggccaagacggcgccgctggtgaaaagagccgccgcgttagccatgcctgctctggca
atcaccgatttcaccaacctgtgcgggctggtgaagttctacggcagcgcgcacggcgcc
gggatcaaaccgatcatcggcgcggatttccatgtgcaaagcgaagtcttgggcgacgaa
ctcgctcagctgacggtgctggccagcaacaacgaaggctaccagaacctgacgctgctg
atttcccgcgcctatcagcgcggctacggcgccgccggcccgatcatcgatcgcgactgg
ctgattgaacatcgcgaagggctgatcctgctctccggcgcgcgtcagggcgacgtcggc
aagttcctgctgcgcggcaaccaggcgcaggtggatcagtgtctggatttctaccagcaa
tatttccccgactgctactacctggagttgatccgcaccggccgcccggatgaagagaac
tatctgcatgcggcggtggcgctggccaccgagcgcggtttgccggtggtggccaccaac
gacgtgcgtttcctggtggaagatgacttcgacgctcatgagatccgcgtcgccatccac
gacggctttacgctggacgatcccaagcggccgcgcaactacagcccgcaacaatacatg
cgcagcgaagacgagatgtgcgagctgttcgccgacatcccggaagcgctgctgaacagc
gtcgaaatcgccaagcgctgcaacgtcaccattcgcctcggcgagtacttcctgccgcag
ttcccgaccggcgatatgagcaccgaggacttcctggtactcaaatcgaaagaggggctg
gaagagcgtctcgagttcctgttccccgatcctgacgtgcgcgcgcagcgccgcccggaa
tacgacgagcgtctggacgtcgagctgaaagtgatcaaccagatggggttccccggctac
ttcctgatcgtgatggaatttatccagtggtcgaaggacaacaacgtgccggtgggccca
gggcgaggctccggcgccggttcgctggtggcctatgcgttgaaaatcaccgacctcgat
ccgctggaattcgacctgctgttcgaacgcttcctgaacccggaacgtgtctcgatgccc
gacttcgacgtcgacttctgcatggagaaacgtgaccaggtaatcgagcacgtggcggag
atgtacggccgcgaagcggtatcgcagatcatcaccttcggcaccatggcggcgaaagcg
gttatccgcgacgtaggccgcgtgttggggcacccgtacgggttcgtcgatcgcatctcc
aaactggtgccgccggatccgggcatgacgctggagaaagccttcgccgccgaaccgcag
ctgccggagatttacgaggccgacgaagaggtcaaagcgctgatcgacatggcccgcaag
ctggaaggggtgacgcgcaacgccggtaaacacgccggtggcgtggtgatcgcgccgacc
aagatcaccgacttcgcgccgctgtactgcgatgccgaagggaaccacccggtgacccag
ttcgacaagaacgacgtggaatacgccgggctggtgaagttcgacttcctcggtctgcgc
accctgaccatcatcgactgggcgctggagatgatcaacgcccggcgcgccaagaccggg
ctggaaccgatcgacatcgccgccatcccgctcgacgacaagaaaagcttcgacatgctg
cagcgttcggaaaccacggcggtgttccagcttgaatcgcgcggcatgaaagatttgatc
aaacgtctgaagcccgactgcttcgaagacatgatcgcactggtggcgctgttccgtccg
gggccgctgcagtcgggcatggtggataacttcatcgaccgcaaacacggccgcgaagag
atctcctacccggacattcagtggcagcatgagtcgctcaagccggtgctggagccgacc
tacggcatcatcctgtatcaggaacaggtgatgcagattgcccaggtgctggccggctat
acgctgggcggcgcggacatgctgcgccgtgcgatgggtaaaaagaacccggtcgaaatg
gccaagcagcgcggcggctttgaagacggcgccaaagcgcgcggcatcgacggcgaactg
tcggtgaaaatcttcgacctggtggagaaattcgccggttatggcttcaacaaatcgcac
tccgccgcctacgcgctggtgtcgtaccagacgctgtggctgaaggcgcactatccggcc
gagtttatggcggcggtgatgaccgccgatatggacaacaccgacaaagtagtggggctg
gtggacgaatgctggcgtatggggctgaagatcctgccgccggacatcaacagcggcctg
tatcacttccacgtcaacgacgacggcgagatcgtttacggcatcggcgccatcaagggc
gtgggggaagggccgatcgaagccattatcgaagcgcgcaacagcggcgagcaaggttat
ttcaaagacctgttcgatctctgcgcgcgctccgacatcaagaaactgaaccgccgcatt
ctggaaaaactgatcatgtccggggcgttcgatcgccttgggccacaccgcgccgcgctg
atgaattcgctcggcgacgcgttgaaagcggcggatcagcatgcgaaagccgaagctatc
ggccaggtggacatgtttggcgtgctggcggaagcgccagagcaggtggagcaatcctac
gccaacatcgcgccctggccggagcaggtggtgttggacggtgaacgggaaacgctggga
ctgtacctgaccggccacccgatcacccaatacctcaaggagatcgaacgttacgccggt
ggccagcgtttgaaagacatgcacccgacggatcggggcaaaatgactaccgccgtcggg
ttggtggtcgccgcgcgggtgatggtgaccaagcgcggcaaccgcatcggcatctgtacg
ctggatgaccgttcgggccgtctggaagtgatgctattcaccgaagcgttagaaaaatac
cagcatttgttggaaaaagaccgtatccttatcgccagtggacaggtcagctttgatgac
tttagcggcgggcttaaaatgatggcccgcgaggtaatggacatcagtgaagcccgggaa
aaatacgctcgcgggcttgctatctcgctgactgacaggcaaattgatgaccagcttttg
aaccgtctccgtcagtcgttggaaccccatcgctcggggacgattccagtgcatctctac
tatcaacgggaagatgcgcgagccaagctgcgttttggcgcaacctggcgcgtgacgccc
accgaccgcttgttgatagacttgcggacgttggtaggcaatgagcaggtggacttggaa
tttgactaa

KEGG   Serratia ureilytica: J0X03_07470
Entry
J0X03_07470       CDS       T07185                                 
Name
(GenBank) DNA polymerase II
  KO
K02345  DNA polymerase III subunit theta [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_07470
   03430 Mismatch repair
    J0X03_07470
   03440 Homologous recombination
    J0X03_07470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_07470
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_07470
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_07470
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_07470
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_07470
SSDB
Motif
Pfam: DNA_pol3_theta
Other DBs
NCBI-ProteinID: QSR08803
LinkDB
Position
complement(1608646..1608834)
AA seq 62 aa
MARKLDSLPQAQREKIETDLLAISVIYNERYGIASTQAETEQQVPDHLLPYFHQRLNYYR
RA
NT seq 189 nt   +upstreamnt  +downstreamnt
atggctcgaaagctggatagcttaccgcaggcgcaacgcgagaaaatagaaaccgatttg
ctggccatcagcgtgatctacaacgaacgctacggcatcgcctccactcaggcggaaaca
gaacaacaggtccccgaccacctgctcccctactttcatcaacggctgaattattatcgc
cgtgcgtaa

KEGG   Serratia ureilytica: J0X03_14190
Entry
J0X03_14190       CDS       T07185                                 
Name
(GenBank) DNA polymerase III subunit theta
  KO
K02345  DNA polymerase III subunit theta [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_14190
   03430 Mismatch repair
    J0X03_14190
   03440 Homologous recombination
    J0X03_14190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_14190
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_14190
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_14190
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_14190
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_14190
SSDB
Motif
Pfam: DNA_pol3_theta DUF3283
Other DBs
NCBI-ProteinID: QSR05608
LinkDB
Position
3030536..3030766
AA seq 76 aa
MGYNLAELSKEEMDRVNVDLAASGVAYKERYNMPVIPEVVEREQPEPLRDYFRERVAHYR
AESHKFSRLPYEPKAK
NT seq 231 nt   +upstreamnt  +downstreamnt
gtgggttacaatctggccgagttgtccaaagaagaaatggacagggtgaatgtggatctc
gccgcctcaggcgtggcgtacaaagagcgttacaacatgccggtgatcccggaagtggtg
gagcgcgagcagccggagccgctgcgcgactattttcgcgagcgcgtggcgcactaccgc
gcggaatcccacaagttttcgcgtctgccttacgaaccgaaggccaaataa

KEGG   Serratia ureilytica: J0X03_14380
Entry
J0X03_14380       CDS       T07185                                 
Symbol
holB
Name
(GenBank) DNA polymerase III subunit delta'
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_14380 (holB)
   03430 Mismatch repair
    J0X03_14380 (holB)
   03440 Homologous recombination
    J0X03_14380 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_14380 (holB)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_14380 (holB)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_14380 (holB)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_14380 (holB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_14380 (holB)
SSDB
Motif
Pfam: DNApol3-delta_C DNA_pol3_delta2 CCP_MauG
Other DBs
NCBI-ProteinID: QSR05641
LinkDB
Position
complement(3067408..3068415)
AA seq 335 aa
MNWYPWLNGPYRQLIGQYADGRGHHALLLHAAAGNGDDALAYGLSRWLICQQRNGEKSCG
ECHSCRLMLAGNHPDYHVLAPEKGKSSLGIEPIRQVIETLYAHAQQGGAKVIWLPQAEQL
TEAAANALLKTLEEPPEKTYFLLGCREPSRLMATLRSRCLYWHLASPDEQLSLQWLGRQA
AGSQTDRVTALRLHDGAPLAAEQLLQPQQWQQRGALCAALSAALPQRDMLSLLPVLNHED
VAERLHWLCALLVDAMKWQQGAHHYVLNQDQQPLVHQLASLLSSSSLQQIVQQWLNCRHQ
LLSVVGVNRELLLTEQLLRWEQMLGAAGYSQPHSL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaactggtacccgtggctgaatggcccttatcgccagctgattgggcagtacgccgac
ggccgtggccatcatgcgctgctgctgcatgcggcggcaggcaatggtgacgatgcgttg
gcctacggcctgagccgttggttgatctgccaacagcgcaacggcgaaaaaagctgcggc
gagtgccacagctgccggttgatgctggcgggcaatcacccggattatcacgtgttggcg
ccggaaaagggcaagagcagcctgggcatcgaaccgatccgccaggtgattgaaacgctg
tacgcccacgcgcaacagggcggcgccaaggtgatttggctgccgcaggccgaacagctg
accgaggcggcggccaacgcgctgttgaaaacgctggaggagccgccggagaaaacctat
tttctgttgggttgccgtgagccgtcgcggctgatggcgacgctgcgcagccgctgcctg
tactggcatttggccagcccggatgagcagctcagcctgcagtggttgggccggcaggcg
gcgggctctcagacagaccgagtcacggcgctgcgcctgcacgacggcgcgcccctggcc
gccgagcagttgttgcaaccgcagcagtggcaacagcgcggcgccctgtgcgccgcattg
agcgccgcgctgccgcaacgcgatatgctgtcgctgttgccggtgctaaaccatgaagac
gtcgccgaacgcctgcattggctgtgcgcgttattggtggacgcaatgaagtggcaacag
ggcgcgcatcactatgtattgaatcaggatcagcagccgctggtgcatcagctggccagc
ctgctgagcagctcctcgctgcaacagattgtgcagcagtggctgaactgccgtcaccag
ctgctcagcgtggtgggcgtcaaccgcgagctgctgctgaccgaacagttacttcgctgg
gaacagatgcttggcgccgccggctattcccaacctcattcgctgtaa

KEGG   Serratia ureilytica: J0X03_18005
Entry
J0X03_18005       CDS       T07185                                 
Symbol
holA
Name
(GenBank) DNA polymerase III subunit delta
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_18005 (holA)
   03430 Mismatch repair
    J0X03_18005 (holA)
   03440 Homologous recombination
    J0X03_18005 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_18005 (holA)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_18005 (holA)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_18005 (holA)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_18005 (holA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_18005 (holA)
SSDB
Motif
Pfam: DNA_pol3_delt_C DNA_pol3_delta
Other DBs
NCBI-ProteinID: QSR06301
LinkDB
Position
3813678..3814712
AA seq 344 aa
MIRIYPEQLAAQLREGLRACYLLSGNEPLLLQESQDLLRQAAQQQQFSEHYSISLDAHTD
WDAIFGICQAMSLFASRQTLLLIFPENGPTAPIGEQLTKLATLLHEDILLILRGPRLTKA
QENSAWFKALSPHGALVSCQTPEQAQLPRWVATRAKAMKLELDDAANQLLCYCYEGNLLA
LSQALERLSLLHPDGKLTLPRVEQAVNDAAHFTPFHWLDALLAGKSKRAWHILQQLQQED
VEPVILLRTLQRELLLLLTLQRRMASAPLRTLFDQHKVWQNRRPLVTQALQRLSSAQLQQ
AVQLLTQIELTLKQDYGQSVWPELETLSMLLCGKPLATSFTDAH
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgatccgcatttatccggaacaacttgccgcgcagctccgagaggggctgcgcgcttgt
tatttattgagcggcaatgaaccgctgctgctgcaggaaagccaggatctgctccggcag
gccgcgcaacagcagcagttcagcgagcactacagcatttccctcgacgcccacaccgac
tgggacgccatcttcggcatctgccaggcgatgagcctgttcgccagccgccagacgctg
ctgctgattttcccggaaaacggcccaacggcgccgatcggcgaacagctgaccaagctc
gccaccctgctgcacgaggatattctgctgatcctgcgcggcccgcgcctcaccaaagcg
caggaaaacagcgcctggttcaaggcgctcagcccgcacggcgccctcgtcagttgccag
acgccggagcaggcacagctgccgcgctgggtcgccacgcgcgccaaggcgatgaagctg
gagttggacgacgcggccaatcagctgttgtgctactgctacgaaggcaacctgctggcg
ctgtcgcaggcgctggagcggctgtcgctgctgcacccggacggcaagctcaccctgccg
cgcgtcgagcaggcggtgaacgacgccgcccacttcacgccgttccactggctggacgcc
ttgctggccggcaagagcaagcgcgcctggcatattttgcagcagctgcagcaagaggac
gtcgagccggtgatcctgttgcgcaccctgcagcgcgaactgctgctgttgctgacgctg
cagcgccgcatggcgtccgcgccactgcgcacgctgttcgatcagcacaaggtctggcag
aaccgccgcccgctggtgacccaggcgctgcaacgcctgtccagcgcccagctgcagcaa
gcggtacagctgctgacgcaaatagagctgaccctcaagcaggactatggccagtcggtc
tggccggaactggaaaccctgtcgatgctgctgtgcggcaaacccctggccacgagtttt
accgatgcccactaa

KEGG   Serratia ureilytica: J0X03_18460
Entry
J0X03_18460       CDS       T07185                                 
Symbol
dnaX
Name
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_18460 (dnaX)
   03430 Mismatch repair
    J0X03_18460 (dnaX)
   03440 Homologous recombination
    J0X03_18460 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_18460 (dnaX)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_18460 (dnaX)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_18460 (dnaX)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_18460 (dnaX)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_18460 (dnaX)
SSDB
Motif
Pfam: DNA_pol3_tau_5 DNA_pol3_delta2 DNA_pol3_gamma3 DNA_pol3_tau_4 AAA RuvB_N AAA_5 AAA_22 AAA_18 ResIII AAA_14 DNA_pol3_delta AAA_24 AAA_assoc_2 AAA_7 EAL TsaE Mg_chelatase VirE SKI AAA_19 AAA_16
Other DBs
NCBI-ProteinID: QSR06388
LinkDB
Position
complement(3913357..3915315)
AA seq 652 aa
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTTIARLLAK
GLNCETGITATPCGQCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPPHVKFLLATTDPQKLPVTILSRCLQFHLKALDV
DQIRQQLETVLTAEQITSDARALQLLARAADGSMRDALSLTDQAIAMGQGQVTAATVSQM
LGTLDDEQPLAILEALVSADGEKVMAQVAQAASRGVDWENLLVETLALLHRIAMVQLLPS
MLDNHYAAVEQRLRELARTLPPADVQLYYQTLLVGRKELAYAPDRRMGVEMTLLRALAFH
PKAVIPEPVALVQTAPAPMAQPQQAASPQPPQFQDAPPPLGQPAAPQRQSSTPLPDATAQ
LLKARSQLQRQQGASTPKKNEPAAPGIARPANSALGRLASVTERSQQRLAEKKVPEKPAK
PEAYRWRAQTEPEAAPEPLATPKALRTALEHEKTPELAAKLVVESLERDAWAAEIDKLKI
PKLVQQLALNAFKQQPEPGKISLHLRSSQRHLNSPSAQKTLADALGELYGGPIELTVVED
DNPAERTPLEWRQAIYEEKLAQARQSIEADTNIQTLRRFFDADLDEESIRPL
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgagctatcaggttctcgcccgtaagtggcgccctcaaacgttcgcagacgtggtcggc
caggaacatgtcctgaccgcgctggccaacggcctctcgctggggcggatccatcacgcc
tatctgttctcgggtacgcgcggcgtggggaaaaccaccatcgcccgcttgctggccaaa
ggcctgaactgtgaaaccggcatcaccgccacgccgtgcggccaatgcgacaactgccgc
gagatcgagcaggggcgcttcgtcgatctgatcgagatcgacgccgcttcccgaaccaag
gtggaagatacccgcgatctgctggacaacgttcagtacgcgccggcgcgcggccgcttc
aaggtctacctgatcgatgaagtgcacatgctctcgcgccacagcttcaacgcgttgctg
aagacgctggaagagccgccgccgcacgtcaaattcctgttggccaccaccgatccgcaa
aaattgccggtgaccattctttcccgctgcctgcagtttcacctcaaagcgctggacgtc
gatcagatccgccagcagctggaaacggtgctgacggcggagcagatcaccagcgacgcc
cgcgcgctgcagctgctggcgcgcgccgccgacggcagcatgcgcgatgcgctgagcctg
accgatcaggcgatcgccatggggcaggggcaggtgacggccgccaccgtcagccagatg
ctcggcacgctcgatgacgagcagccgctggcgatcctcgaagcgctggtcagcgccgac
ggtgaaaaggtgatggcgcaggtcgcgcaggccgcttcgcgcggcgtggattgggaaaac
ctgctggtggagacgctggcgttgctgcatcgcattgcgatggtgcaactgctgccttcg
atgctcgacaaccactacgccgccgtggaacaacggctgcgcgagctggcgcgcaccctg
ccgccggccgatgtgcaactctattaccagacgctgttggtgggccgcaaagagctggcc
tatgcgccggatcgccgcatgggggttgagatgaccctgctgcgcgcgctggcgtttcac
ccgaaagcggtgatcccggagccggtggcgttggtgcagaccgcgccggcgccgatggcg
cagccgcagcaggccgcatcgccacagccgccgcagtttcaggacgcgccgccgccgcta
gggcagccggccgcgccgcagcgacaatcatcgactcctttaccggatgccaccgcccag
ctgttgaaagcgcggtcccagctgcaacggcagcagggagcatccacaccaaaaaagaat
gagccggcggcgccaggaatagcgcggccggcaaactcggcgctggggcgtttggcttcc
gtgaccgagcgcagccagcagcgcctggcggagaagaaggtgccggaaaaaccggcgaaa
ccggaagcctatcgttggcgcgcgcagaccgagcccgaggcggcgccggaaccgctggca
acgccgaaagcgctgcgcacggcgttggagcacgagaaaacgccggagctggccgccaag
ctggtggtggagtcgctggagcgcgacgcctgggcggcggaaatcgataagctgaagatc
ccgaaactggtgcagcagctggcgttgaacgccttcaagcagcagccggagccgggcaag
attagcctccatctgcggtcttcgcagcgccatctgaattcgccttcggcgcagaagacg
ctggccgacgcgctcggtgagctgtacggcggtccgatcgagctgaccgtggtggaggac
gataatccggcggagcgcaccccgctggaatggcgacaagccatctatgaggaaaagctg
gcgcaggcgcgccagtccatcgaagcggataccaacattcagacgctgcgccgattcttc
gacgcggatctggatgaagagagtattcgccccctttaa

KEGG   Serratia ureilytica: J0X03_19555
Entry
J0X03_19555       CDS       T07185                                 
Symbol
dnaQ
Name
(GenBank) DNA polymerase III subunit epsilon
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_19555 (dnaQ)
   03430 Mismatch repair
    J0X03_19555 (dnaQ)
   03440 Homologous recombination
    J0X03_19555 (dnaQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_19555 (dnaQ)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_19555 (dnaQ)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_19555 (dnaQ)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_19555 (dnaQ)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_19555 (dnaQ)
SSDB
Motif
Pfam: RNase_T Rv2179c-like DNA_pol_A_exo1 vATP-synt_AC39
Other DBs
NCBI-ProteinID: QSR06595
LinkDB
Position
complement(4128204..4128947)
AA seq 247 aa
MISTTTRQIVLDTETTGMNKLGVHYEGHRIIEIGAVEVINRRLTGRNFHVYIKPDRLVDP
EAYGVHGISDDFLADKPTFDQVADEFLDFIRGGELVIHNAAFDIGFMDHEFRMLQQGIPK
TETFCTITDSLMMARRLFPGKRNNLDALCSRYEIDNSKRTLHGALLDAEILAEVYLAMTG
GQTSIAFQMEGDTQQNDAAQEIQRIVRPATAMKVVYASDEEIKAHEARLDLVAKKGGSCL
WRGAPAE
NT seq 744 nt   +upstreamnt  +downstreamnt
atgatctctacaaccaccagacagattgtcctcgataccgaaaccaccggtatgaacaag
cttggggtgcactacgaagggcaccgcatcatcgaaatcggtgcggtggaagtgattaac
cgccgcctgaccgggcgcaacttccacgtatacatcaagccggatcggctggtggatccg
gaagcgtacggcgtacacggcatcagcgacgacttcctggccgacaaacctaccttcgat
caggttgccgacgaattcctcgactttatccgcggcggcgagctggtgatccataacgcg
gcgttcgatatcggctttatggatcacgaattccgcatgctgcagcaggggatcccgaag
accgagaccttctgcaccatcaccgacagcctgatgatggcgcgccgcctgttcccgggc
aagcgcaacaacctcgatgccttgtgcagccgctatgagatagacaacagcaagcgtacg
ctgcacggcgcattgctcgatgccgagatcctggcggaagtctatctggcgatgaccggc
ggtcagacgtcgatagcgttccaaatggaaggcgacacccagcaaaacgatgccgcgcaa
gaaatacagcgtatcgtccgcccggctacggcgatgaaagtggtctacgccagcgacgaa
gaaataaaggcgcacgaggcgcgtctggatctggtggcgaagaagggcggcagctgcctg
tggcgcggggcgccggcggaataa

KEGG   Serratia ureilytica: J0X03_20920
Entry
J0X03_20920       CDS       T07185                                 
Name
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_20920
   03430 Mismatch repair
    J0X03_20920
   03440 Homologous recombination
    J0X03_20920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_20920
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_20920
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_20920
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_20920
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_20920
SSDB
Motif
Pfam: DNA_III_psi Inhibitor_I66
Other DBs
NCBI-ProteinID: QSR06844
LinkDB
Position
complement(4423059..4423496)
AA seq 145 aa
MASKRDWLLQQLGITQWTLRRPGVLQGEVAVSLPPETRLLVVAQTQPAPDDPLFCDVLRS
LGLTPAQTYSLTPEQVAMLPEETACNSWRLGVTEPLAVAGAQLHSPALAELSQDAGAKRA
LWQQICHHEHDFYPDGGRPGHGLQH
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcatcaaaacgcgactggctgttacaacaactgggtattacgcagtggacattgcgc
cgcccgggcgtgttgcagggcgaagtggcggtcagtctgccgcccgagacgcgcctgctg
gtggtggcgcagacgcagccggcgcccgacgatccgctgttttgcgacgtgctgcgcagc
ctggggctgacgccggcgcaaacctacagcctgacgccggaacaggtggcgatgctgcct
gaagagaccgcatgcaacagttggcggctgggcgtgacggaaccgctcgcggtcgccggc
gcgcagctacacagcccggcgctggccgagctttcccaagacgcgggggccaaacgcgcc
ctctggcagcagatttgtcatcatgaacacgatttctaccctgacggcggccgacctggc
cacggccttcaacattga

KEGG   Serratia ureilytica: J0X03_21500
Entry
J0X03_21500       CDS       T07185                                 
Name
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_21500
   03430 Mismatch repair
    J0X03_21500
   03440 Homologous recombination
    J0X03_21500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_21500
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_21500
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_21500
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_21500
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_21500
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: QSR06947
LinkDB
Position
4543072..4543521
AA seq 149 aa
MKQATFYLLDNAEPSGALSAHEAVACAVAASGFRSGKRVLIACESQEQAQRLDEALWQRE
PHEFVPHNLAGEGPHYGAPVELCWPGKRGNAPRDLLIALLPQFADFATAFHEVVDFVPYE
DTLKQLARDRYKAYRSVGFHLTTATPPTH
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaacaggcgacgttttatttgctcgacaacgcggaaccgtcaggcgcgctcagcgcc
catgaggccgtggcctgcgccgttgccgccagcggcttccgttccggcaagcgggtgctg
atcgcctgcgagagccaggagcaggcccagcggctggacgaagcgctgtggcagcgcgag
ccgcatgaattcgtgccgcacaacctggccggcgaagggccgcactacggcgcgccggtg
gaactgtgctggcccggcaagcgcggcaacgccccgcgcgatctgctgatcgccctgctg
ccgcagtttgccgattttgctaccgctttccatgaagtggtagacttcgttccttacgaa
gacactctgaaacagttggcgcgcgaccgttacaaggcctatcgcagcgtcggcttccat
ttgaccacggctacgccgccaactcactga

KEGG   Serratia ureilytica: J0X03_23805
Entry
J0X03_23805       CDS       T07185                                 
Symbol
dnaN
Name
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
suri  Serratia ureilytica
Pathway
suri03030  DNA replication
suri03430  Mismatch repair
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    J0X03_23805 (dnaN)
   03430 Mismatch repair
    J0X03_23805 (dnaN)
   03440 Homologous recombination
    J0X03_23805 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suri03032]
    J0X03_23805 (dnaN)
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_23805 (dnaN)
Enzymes [BR:suri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     J0X03_23805 (dnaN)
DNA replication proteins [BR:suri03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     J0X03_23805 (dnaN)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     J0X03_23805 (dnaN)
SSDB
Motif
Pfam: DNA_pol3_beta_2 DNA_pol3_beta DNA_pol3_beta_3
Other DBs
NCBI-ProteinID: QSR07363
LinkDB
Position
complement(5034720..5035820)
AA seq 366 aa
MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLLLTGTDLEMEMVARVALS
QPHEPGATTVPARKFFDICRGLPEGAEIAVTLESERMLVRSGRSRFSLSTLPAADFPNLD
DWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVC
SMPIGQQLPSHSVIVPRKGVMELVRLLDGGDSLLQLQIGSNNIRAHVGDFIFTSKLVDGR
FPDYRRVLPKNPDKTLEAGCDLLKQAFARAAILSNEKFRGVRLYVSQNQLKITANNPEQE
EAEEILDVSYDGAEMEIGFNVSYVLDVLNALKCEDVRLLLTDSVSSVQIEDGASQAAAYV
VMPMRL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaatttatcgttgaacgtgagcatctgctaaaaccgctgcaacaggtgagcagcccg
ctgggcggccgcccgaccttgccgatcctgggcaacctgctgttgcaggtgacggaaggc
tccctgctgctgaccggcaccgatctggagatggaaatggtggcgcgcgtcgccctgtcc
cagccgcatgagccgggcgcgaccaccgtgcccgcgcgcaaattctttgatatctgccgt
ggcctgccggaaggggcggagatcgccgtcacgctggagagcgagcgcatgctggtgcga
tccggccgcagccgtttctcgctgtccacgctgcccgcggcggacttcccgaacctggac
gactggcagagcgaggtggaattcaccttgccgcaggcgacgctgaagcgcctgatcgaa
gccacccagttctcgatggcccatcaggacgtacgttactacctgaacggcatgctgttt
gaaaccgaaggcgaagagctgcgcaccgtcgcgacagacggccaccgcctggcggtgtgc
tcgatgccgatcggccagcagctgccgtcgcattcggtgatcgtgccgcgtaaaggggtg
atggagctggtgcgcttgctggacggcggcgattcgctgctgcagctgcagatcggcagc
aacaacattcgcgcccacgtcggcgatttcatcttcacgtccaagctggttgacggccgt
ttcccggactatcgccgcgttttgccgaagaacccggacaaaacgctggaagccggctgc
gatctgctcaagcaggcgttcgcccgcgcggctattctctcgaacgagaaattccgcggc
gtgcggctgtacgtcagccagaatcagctgaagatcaccgccaacaacccggaacaggaa
gaggcggaagagatcctcgacgtcagctacgacggcgcggagatggagatcggcttcaac
gtcagctacgtgctggacgtgttgaacgcgctcaagtgtgaagacgtgcgcctgctgttg
accgactcggtctccagcgtgcagatcgaagacggcgccagccaggcggcggcctacgtt
gtcatgccaatgcggttgtag

DBGET integrated database retrieval system