KEGG   Serratia ureilytica: J0X03_05070
Entry
J0X03_05070       CDS       T07185                                 
Symbol
recO
Name
(GenBank) DNA repair protein RecO
  KO
K03584  DNA repair protein RecO (recombination protein O)
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_05070 (recO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_05070 (recO)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     J0X03_05070 (recO)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      J0X03_05070 (recO)
SSDB
Motif
Pfam: RecO_N RecO_C
Other DBs
NCBI-ProteinID: QSR08356
LinkDB
Position
1094075..1094806
AA seq 243 aa
MDGWERAFVLHGRPYSETSLMLDLFTEGHGRVRLLAKGARSRRSNLKGCLQPFTPLLVRW
GGRGEVKTLRNAEAVSLGLPLSGMMLYSGLYVNELLARVLEQETNYSVLFFDYLQCLQAL
AAEDSSPEQALRQFELALLQHLGYGLDFLHCAGSGLPVDDAMTYRYREEKGFIASLVVDH
YSFTGRELRALAERQFPDAETLRAAKRFTRMALKPYLGGKPLKSRELFRQFVRKQPNTPV
DDA
NT seq 732 nt   +upstreamnt  +downstreamnt
gtggacggctgggagcgcgctttcgtcctgcatgggcggccgtacagtgaaaccagtctg
atgctggatctgtttaccgaaggtcatgggcgggtgcgcttgctggcaaaaggcgcgcgc
agccgccgctccaatctgaagggttgcctgcagccctttacccccctgttagtgcgctgg
ggcggccgcggcgaagtgaaaacgctgcgtaacgccgaagcggtctctctcggtttaccc
ctcagcggcatgatgctttacagcggcctgtacgtgaacgaactgctggcgcgcgtgctg
gagcaggaaaccaactactcggtgctgttcttcgactacctgcaatgcctgcaggcgctg
gcggcggaagacagctcgccggaacaggcgttgcgccagttcgagctggccttgttgcag
cacctgggttacggcctcgatttcctgcactgcgccggcagcggcctgccggtggatgac
gccatgacctaccgctaccgtgaagagaaaggctttatcgccagcctggtggtggatcac
tacagcttcaccgggcgcgaactgcgcgcgctggcggagcggcagtttcccgatgccgag
acgctgcgcgccgccaagcgcttcacccgcatggcgctgaaaccctacctcggcggcaag
ccgttgaagagccgcgaactgtttcgccaattcgtgcgcaaacagccgaatacgccggtc
gacgacgcctga

DBGET integrated database retrieval system