KEGG   Serratia ureilytica: J0X03_05375
Entry
J0X03_05375       CDS       T07185                                 
Symbol
xseA
Name
(GenBank) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_05375 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_05375 (xseA)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     J0X03_05375 (xseA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     J0X03_05375 (xseA)
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon
Other DBs
NCBI-ProteinID: QSR08415
LinkDB
Position
complement(1160584..1161960)
AA seq 458 aa
MSLPVSPSIFTVSRLNQTVRQLLEMEMGQIWLSAEISNLSQPASGHWYFTLKDDRAQVRC
AMFRNSNRRVTFRPQNGQQVLVRASITLYEPRGDYQLIAESMQPAGDGLLQQQFEQLKQR
LSAEGLFDQQFKQPLPAPAKRVGVITSASGAALHDILQVLQRRDPSLPIVIYPTSVQGAE
APMQIVRAIETANRRDECDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHET
DVTIADFVADLRAPTPSAAAELVSRNQLELLRQLQSQQQRLEMAMDYYLAQRQQQFTRIH
HRLQQQHPHLRLARQQTLLFKLQRRMEDGMQQQLRLAARRSERVQQRLAQVQPQGRIHRY
QQRVQQQEYRLQQAMERQLNAYRQRFGVACSQLETVSPLATLARGYSVTQTPRGELLKTT
KQAQVGELLKTRLQDGWVESEVKTITVAKKPRKKRAAE
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgtcgctacctgtttcgccttccatttttaccgtaagccgcctgaatcagacggttcgc
caactgctggaaatggaaatggggcagatttggctctccgccgagatctccaacctctcc
cagcccgcctccggccactggtatttcaccctgaaagacgaccgcgcccaggtgcgctgc
gcgatgttccgcaacagcaatcgccgcgtcaccttccggccgcaaaacggccagcaggtc
ttggtgcgcgccagcatcacgctgtatgaaccgcgcggcgactaccagctgatcgccgag
agcatgcagcccgccggcgacggcctgctgcagcaacagttcgagcagttgaaacagcgc
ctgagcgccgaagggctgttcgatcagcagttcaagcagccgctgcccgccccggccaaa
cgcgtcggggtgatcacctccgccagcggcgcggcgctgcacgatatcctgcaggtattg
cagcggcgcgatccgtcgctgccgatcgtcatctaccccacctcggtgcagggcgcggaa
gcgccgatgcagatcgtgcgcgccatcgagaccgccaaccgccgcgatgaatgcgacgtg
ctgatcgtcggccgcggcggcggttcgctggaggatctgtggagcttcaacgacgaacgc
gtggcgcgggcgatcttcgccagccgcattccgatcgtcagcgccgtcggccatgaaacc
gacgtcaccatcgccgacttcgtcgccgatctgcgcgcgccgaccccttccgccgccgcc
gaactggtgagccgcaatcagctcgagctgttgcgccagctgcagtcgcagcagcagcgg
ctggagatggcgatggattactacctggcgcagcgccagcagcagttcacccgcattcat
caccgtttacagcagcagcatccgcatctgcgcctggcgcgccagcagacgctgctgttc
aagctgcagcgccgaatggaagacggcatgcagcagcagctgcgcctggccgcccgccgc
agcgaacgcgtccagcagcggctggcgcaggtgcagccgcagggccgcattcaccgctac
caacagcgcgtgcagcagcaggaataccgtctgcagcaggcgatggagcgccagctcaac
gcctaccgccagcgtttcggcgtggcgtgcagccagctggagaccgtcagcccgctggcg
acgctggcgcgcggctacagcgtgacgcaaactccgcgcggcgagctgctgaaaaccacc
aagcaggcgcaggtcggcgagctgctgaaaacccgcctgcaggatggctgggtggaaagc
gaggtgaaaaccatcaccgtcgccaaaaagccacgcaagaagcgcgcggccgagtaa

KEGG   Serratia ureilytica: J0X03_18810
Entry
J0X03_18810       CDS       T07185                                 
Symbol
xseB
Name
(GenBank) exodeoxyribonuclease VII small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_18810 (xseB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_18810 (xseB)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     J0X03_18810 (xseB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     J0X03_18810 (xseB)
SSDB
Motif
Pfam: Exonuc_VII_S Dynamitin DUF6687
Other DBs
NCBI-ProteinID: QSR06454
LinkDB
Position
3984041..3984304
AA seq 87 aa
MPKKPAQSASTEQTASFESALGELESIVTRLESGELPLEDALNEFERGVQLARQGQQKLQ
QAEQRVQILLNDSADDAALAPFTPDTE
NT seq 264 nt   +upstreamnt  +downstreamnt
atgccgaaaaaaccagcacaatcagccagtacagagcaaacagccagctttgaaagcgcc
ctcggcgagctggaaagcatcgtgacgcgtctggagtcgggcgaactgccgctggaagac
gcgctgaacgaattcgaacgcggcgtgcagctggcgcgtcaaggccagcagaaactgcaa
caggcggaacagcgtgtgcaaatcctccttaacgacagcgccgacgacgcggcgttggcg
cctttcacaccggataccgagtaa

DBGET integrated database retrieval system