KEGG   Serratia ureilytica: J0X03_07390
Entry
J0X03_07390       CDS       T07185                                 
Symbol
nfo
Name
(GenBank) deoxyribonuclease IV
  KO
K01151  deoxyribonuclease IV [EC:3.1.21.2]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_07390 (nfo)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_07390 (nfo)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.2  deoxyribonuclease IV
     J0X03_07390 (nfo)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     J0X03_07390 (nfo)
SSDB
Motif
Pfam: AP_endonuc_2 Flagellin_IN
Other DBs
NCBI-ProteinID: QSR08787
LinkDB
Position
complement(1588407..1589246)
AA seq 279 aa
MKFVGAHVSASGGVDQAVIRAHELEATAFALFTKNQRQWKAAPLAADVIDKFKSACAQYG
YGPGQILPHDSYLINLGHPVADALEKSREAFIDELQRCEQLGLTLLNFHPGSHLLQIDED
KCLARIAESINIALDKTAGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDT
CHAFAAGYDLRTEEECERTFKQLGDIVGFNYLRGMHLNDAKSEFNSRVDRHHSLGEGNIG
KTVFSYIMRDPRFDNIPLILETVNPDIWAEEIAWLKAQQ
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaagtttgtcggtgcacatgtcagcgcgtcaggcggcgtggatcaggcggttatccgc
gcgcacgaattggaggcgaccgcgttcgccctgttcaccaaaaatcagcgtcaatggaag
gccgccccgctggccgccgacgtgatcgataagttcaagagcgcctgcgcccagtacggt
tacgggccggggcaaatcctgccgcacgacagctacctgatcaatctggggcacccggta
gccgacgcgttggaaaaatcgcgcgaggcatttatcgacgagctgcagcgctgcgaacag
ctggggctgacgctgctgaacttccaccccggcagccacctgctacaaatcgacgaagat
aaatgcctggcgcgcatcgccgaatcgatcaacatcgcgctggataaaaccgccggcgtg
acggccgtgatcgagaacaccgccggccagggcagcaacctgggcttcaaattcgagcac
ctggcggcgatcatcgacggcgtcgaagacaaaagccgcgtcggcgtttgcatcgacacc
tgccacgccttcgccgccgggtacgatctgcgcaccgaagaagagtgcgagcgcaccttc
aagcagttgggcgacatcgtcggtttcaactacctgcgcggcatgcacctgaacgacgcc
aagagcgagttcaacagccgcgtcgaccgccatcacagcctgggggaaggcaacatcggc
aaaacggtgttcagctacatcatgcgcgatccgcgtttcgacaacatcccgctgattctg
gaaacggtaaacccggatatctgggccgaagagatcgcctggctgaaggcgcagcagtaa

DBGET integrated database retrieval system