KEGG   Serratia ureilytica: J0X03_07465
Entry
J0X03_07465       CDS       T07185                                 
Symbol
sbcB
Name
(GenBank) exodeoxyribonuclease I
  KO
K01141  exodeoxyribonuclease I [EC:3.1.11.1]
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_07465 (sbcB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_07465 (sbcB)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.1  exodeoxyribonuclease I
     J0X03_07465 (sbcB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     J0X03_07465 (sbcB)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_07465 (sbcB)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      J0X03_07465 (sbcB)
SSDB
Motif
Pfam: Exonuc_X-T_C RNase_T
Other DBs
NCBI-ProteinID: QSR08802
LinkDB
Position
complement(1607128..1608555)
AA seq 475 aa
MSSKATATFYIHDYETFGKSPSLDRPAQFAGVRTDMDFNIIEEPLVIYCAPADDYLPEPE
AVMITGITPQVARAKGVNEAEFTRQIHQAFSVAGTCILGYNNIRFDDEVSRNIFYRNFYD
PYAYSWQNGNSRWDLLDVMRACYALRPDGIVWPENEDGFPSFRLEHLTRANGVEHTQAHD
AMSDVYATIAMAKLVKQAQPRLFDFLLQHRNKHKLNALIDVADMTPLVHVSGMFGAARGN
TSWVSPLAWHPDNKNAVIMCDLAGDMTPLLTLSAEQLRERLYTRRDDLAPDQAPVPIKLV
HINKCPVLAPAKTLLPENAERLGIDRQACLQNLQLLKQHPEVREKVVALFAEAEPFKGSE
DVDARLYDGFFSDADKAAMRIIQQTKPQNLPALDLAFSDDRMKELLFRFRARNYPNTLDD
AEQRRWLQHRQEALSAERVQSYLLQLESLYNLHEGDKEKTALLKALFDYGKELVG
NT seq 1428 nt   +upstreamnt  +downstreamnt
ttgagcagcaaggcaacggccacattttacattcacgattacgagaccttcggcaagagc
ccgtcgctggaccgcccggcgcagttcgccggcgtgcgcaccgatatggatttcaacatt
atcgaagagccgctggtcatctactgcgccccggccgacgattacctgccggagccggag
gcggtgatgatcaccggcatcacgccgcaggtggcgcgcgccaaaggcgttaacgaagcc
gaattcacccgccaaatccatcaggccttcagcgtggccggcacctgcattctcggttac
aacaacatccgcttcgatgacgaagtgagccgcaatatcttctatcgcaacttctacgat
ccctacgcctacagctggcaaaacggcaactcgcgctgggatctgctggatgtgatgcgc
gcctgctacgctctgcgcccggacggcatcgtttggccggaaaacgaagacggtttcccc
agcttccgcctggaacacctgacgcgtgccaacggcgtcgagcacacgcaggctcacgat
gcgatgtcggacgtttacgccaccatcgccatggccaagctggtcaagcaggcgcagccg
cggctgttcgatttcctgttgcagcaccgcaataaacacaagctgaacgccctgatcgac
gtcgccgacatgacgccgctggtgcacgtctccggcatgttcggcgcggcgcgcggcaat
accagctgggtatcgccgctggcctggcacccggacaacaagaacgcggtgatcatgtgc
gatctggccggcgacatgacgccgctgttgacgctgagcgccgagcagctgcgtgagcgg
ctgtacacccgccgcgacgatctggcgccggatcaggcgccggtgccgatcaagctggtg
cacatcaacaaatgcccggtgctggcgccggccaaaaccctgctgccggagaacgccgag
cggctgggcatcgatcgtcaggcgtgcctgcaaaatctgcagctgctgaaacagcatccg
gaagtgcgcgagaaagtggtcgcgctgttcgccgaagccgagccgttcaaaggttccgag
gacgtcgacgcccgcttgtacgacggtttcttcagcgacgccgacaaggcggcgatgagg
attatccagcagaccaagccgcagaacctgccggcgctggatctggccttcagcgacgac
cgcatgaaagagctgctgttccgcttccgcgcgcgcaactacccgaatacgctggacgac
gccgagcagcgccgctggctgcaacatcgtcaggaagccttgagcgcggagcgcgtgcag
agctatctgctgcagctcgaatcgctgtataacctgcacgaaggcgacaaagagaaaacc
gccctgctgaaagcgctgttcgattacggcaaagagttggtgggataa

DBGET integrated database retrieval system