KEGG   Serratia ureilytica: J0X03_10005
Entry
J0X03_10005       CDS       T07185                                 
Symbol
ruvC
Name
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.21.10]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_10005 (ruvC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_10005 (ruvC)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.10  crossover junction endodeoxyribonuclease
     J0X03_10005 (ruvC)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_10005 (ruvC)
    RecFOR pathway proteins
     J0X03_10005 (ruvC)
SSDB
Motif
Pfam: RuvC DUF3882 NeuB Arm-DNA-bind_1
Other DBs
NCBI-ProteinID: QSR09271
LinkDB
Position
2151639..2152160
AA seq 173 aa
MAIILGIDPGSRVTGYGLIRQQGRQLSYIASGCIRTVVDDMPTRLKLIYAGVSEIITQFQ
PDFFAIEQVFMAKNPDSALKLGQARGVAIVAAVNQNLEVFEYAARQVKQTVVGTGAAEKA
QVQHMVRSLLKLSANPQADAADALAIAITHCHLSQNVLRMSEGRLNLARGRLR
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcgatcatactcggtatcgatcccggctcacgcgtcaccggctatggccttatccgc
cagcaagggcgccagttgagctatatcgccagcggctgcatccgcacggtggtggacgac
atgccgacgcggctgaagctgatttacgccggcgtcagcgagatcatcacccagtttcag
ccagacttcttcgccatcgaacaggtgtttatggccaagaacccggattcggcgctcaag
ctcggccaggcgcgcggcgtcgcgatcgtcgcggcggtgaatcagaatctggaagtgttc
gagtatgcggcgcggcaggtcaaacaaaccgtggtcggcaccggcgcagccgaaaaggcg
caggtgcagcacatggtgcgctcgctgctcaaactctcggccaacccgcaggcggacgcc
gccgacgccctggccatcgccatcacccactgccacctcagccagaacgtgctgcggatg
agcgaagggcggcttaacctggcgcgcgggcgtttgcgctga

DBGET integrated database retrieval system