KEGG   Serratia ureilytica: J0X03_10010
Entry
J0X03_10010       CDS       T07185                                 
Symbol
ruvA
Name
(GenBank) Holliday junction branch migration protein RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:5.6.2.4]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_10010 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_10010 (ruvA)
Enzymes [BR:suri01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     J0X03_10010 (ruvA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_10010 (ruvA)
    RecFOR pathway proteins
     J0X03_10010 (ruvA)
SSDB
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_8 HHH_2 Transposase_20
Other DBs
NCBI-ProteinID: QSR09272
LinkDB
Position
2152273..2152884
AA seq 203 aa
MIGRLRGNILEKQPPLVLLEANGVGYEVHMPMTCFYELPELGQEAIVFTHFVVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVSAVEREEITALVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNSSEISLPSAAEKAPEADAEAEAVSALVALGYKPQEASRM
VSKIAKPGADCETLIRDALRAAL
NT seq 612 nt   +upstreamnt  +downstreamnt
atgataggtcgtctcagaggaaatattctggaaaagcagccgccgctggtgttattggag
gcgaacggcgtgggctatgaagtgcacatgccgatgacctgcttttacgagctgccggaa
ctggggcaagaggccatcgtgtttacccacttcgtggtgcgcgaagacgcgcagctgctg
tacggtttcaacgataagcaagagcgcgcgctgttccgcgagctgatcaaggtcaacggc
gtcgggccgaaactggcgctcgccatcctgtccggcatgtccgcgcagcagttcgtcagc
gcggtggagcgtgaagagatcaccgcactggtcaagctgccgggcgtgggcaagaaaacc
gccgaacgcctggtggtagagatgaaagaccgcttcaaagggctcaacggcgatctgttc
aacagcagcgagatcagcttgccgtccgccgctgagaaagcgcctgaggcggatgcggag
gccgaagcggtctcggcattggtggcgctgggctataagccgcaggaagccagccgcatg
gtcagcaaaattgccaaaccgggtgccgactgcgagaccctgatccgcgacgcgttgcgc
gctgctttgtaa

DBGET integrated database retrieval system