KEGG   Serratia ureilytica: J0X03_10015
Entry
J0X03_10015       CDS       T07185                                 
Symbol
ruvB
Name
(GenBank) Holliday junction branch migration DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:5.6.2.4]
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_10015 (ruvB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_10015 (ruvB)
Enzymes [BR:suri01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     J0X03_10015 (ruvB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_10015 (ruvB)
    RecFOR pathway proteins
     J0X03_10015 (ruvB)
SSDB
Motif
Pfam: RuvB_N AAA_lid_4 RuvB_C AAA AAA_5 TIP49 AAA_22 Mg_chelatase AAA_3 Sigma54_activat Rad17 AAA_16 AAA_14 AAA_18 NTPase_1 Bac_DnaA RNA_helicase AAA_24 AAA_17 TsaE NB-ARC bpMoxR AAA_28 ABC_tran
Other DBs
NCBI-ProteinID: QSR09273
LinkDB
Position
2152904..2153908
AA seq 334 aa
MIEADRLISAEPLNEEEVLDRAIRPKLLTEYVGQPHVREQMEIFIQAAKQRGDALDHLLI
FGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSP
VVEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGSLTSPLRDRFGIVQR
LEFYQVADLQHIVSRSAGCLGLELSDEGAHEVARRARGTPRIANRLLRRVRDFAEVRANG
VISGAVAAQALDMLNVDAEGFDYMDRKLLLAIIDKFTGGPVGLDNLAAAIGEERETIEDV
IEPFLIQQGFIQRTPRGRLATQHAYRHFGLEREA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgattgaagccgatcgcctgatctccgccgaaccgctcaacgaggaagaagtcctcgat
cgcgccattcgtcctaagctgttgaccgaatatgtgggccagccgcacgtacgcgagcag
atggagattttcatccaggcggctaagcagcgcggcgacgcgctcgaccacttgctgatc
ttcggtccgccggggctggggaaaaccaccctggccaacatcgtggccaacgaaatgggc
gtgaatttgcgtaccacctccggcccggtgctggagaaggcgggcgatctggcggcgatg
ctgaccaacctcgaaccgcacgacgtgttgttcatcgacgaaatccaccgcctgtcaccg
gtggtggaagaggtgctgtatccggcgatggaagactatcagctggatatcatgatcggc
gaagggccggcggcgcgctcgattaagctcgatctgccgccgtttaccttggtgggtgca
accacccgcgccggttcgctgacctcaccgctgcgcgatcgcttcggcattgtccagcgg
ctggagttttatcaggtggccgatctgcagcacatcgtctcacgcagcgccgggtgcctg
gggctggagctgtccgacgagggcgcccatgaggtagcccgccgcgcgcgcggcacgccg
cgtatcgccaaccgtctgttgcgccgggtgcgcgacttcgccgaagtgcgcgccaacggc
gtgatcagcggcgcggtggcggcgcaggcgctcgatatgcttaacgtcgatgccgaaggc
ttcgactatatggatcgcaaactgctgttggcgattatcgacaagtttaccggtggcccg
gtcgggttggataacctggcggcggcgatcggcgaggagcgcgagaccatcgaagacgtg
atcgaaccgttcctgatccagcagggctttatccagcgcacgccgcgcggccgtctggcg
acgcagcacgcctaccggcatttcggcctcgaacgcgaagcgtaa

DBGET integrated database retrieval system