KEGG   Serratia ureilytica: J0X03_12680
Entry
J0X03_12680       CDS       T07185                                 
Symbol
nth
Name
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_12680 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_12680 (nth)
Enzymes [BR:suri01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     J0X03_12680 (nth)
DNA repair and recombination proteins [BR:suri03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_12680 (nth)
 Prokaryotic type
     J0X03_12680 (nth)
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S
Other DBs
NCBI-ProteinID: QSR05332
LinkDB
Position
2734130..2734771
AA seq 213 aa
MNKQKRLEILTRLRDNNPHPTTELVYTTPFELLIAVLLSAQATDVSVNKATAKLYPVANT
PAAMLALGVDGVKEYIKTIGLFNSKAENVIKTCRMLLELHGGEVPEDRAALEALPGVGRK
TANVVLNTAFGWATIAVDTHIFRVCNRTHFAPGKNVDQVEEKLLKVVPAEFKVDCHHWLI
LHGRYTCIARKPRCGSCIIEDLCEYKEKVYPES
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaacaagcagaagcgactggaaattctgacccggctgcgcgacaacaatccgcatccg
accaccgagctggtgtacaccacgccgtttgagctgctgatcgcggtattgctgtctgcg
caggccaccgacgtgagcgttaacaaggcgaccgccaaactctatccggtcgccaacacc
cccgccgccatgctggcgctgggggttgatggcgtcaaggagtacatcaagaccatcggt
ctgttcaacagcaaggccgaaaacgtgatcaagacctgccgcatgctgctggagctgcac
ggcggcgaagtgccggaagatcgcgccgcgctggaggcactgccgggcgttggccgcaaa
accgccaacgtggtgctcaacaccgccttcggctgggcgaccatcgccgtggacacccat
atcttccgggtgtgcaaccgcacccactttgcgccgggcaagaacgtcgatcaggtggag
gagaaactgttgaaggtggtgcccgccgaattcaaggtcgattgccatcactggttgatc
ctgcacggacgctacacctgcatcgcgcgcaaaccgcgctgcggctcctgcatcatcgaa
gacctgtgcgaatataaagaaaaggtttatccggaatcctga

DBGET integrated database retrieval system