KEGG   Serratia ureilytica: J0X03_17710
Entry
J0X03_17710       CDS       T07185                                 
Symbol
nei
Name
(GenBank) endonuclease VIII
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
suri  Serratia ureilytica
Pathway
suri03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    J0X03_17710 (nei)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_17710 (nei)
Enzymes [BR:suri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     J0X03_17710 (nei)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     J0X03_17710 (nei)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     J0X03_17710 (nei)
SSDB
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS NFACT_N
Other DBs
NCBI-ProteinID: QSR06249
LinkDB
Position
complement(3753374..3754165)
AA seq 263 aa
MPEGPEIRRAADKLAAAVIDQPLTAVDFAFPQLKHYRQRLLGERIVAIEPRGKALLTHFS
NGLTMYSHNQLYGVWKVAAAGETPETKRDLRVRLETARSAILLYSASDITVGPREEIEQH
PFLQRIGPDVLDMSLTVDDVAERLLTPRFRRRQLGGMLLDQAFLAGLGNYLRAEILWQAE
LAPQHKPQDLTPEALRHLAEALLAVPRLSYQTRGQADDNRHHGALFRFKVFHRSGEPCER
CGGMIVRTELSSRPFYWCPGCQK
NT seq 792 nt   +upstreamnt  +downstreamnt
atgccggaaggaccggagattcgccgggcggcggacaaactggcggcggcggtgatcgat
cagccgctgaccgccgtcgatttcgcttttccccagctgaaacactatcgccagcgtctg
ctcggcgagcgcatcgtcgccatcgagccgcgtggcaaggcgctgctgacccatttctcc
aatgggctgacgatgtacagccacaaccagctgtacggcgtatggaaagtggcggcggcg
ggagagacgccggagaccaagcgcgatctgcgggtgcggctggaaaccgctcgcagcgca
atattgctttacagcgcttccgacatcaccgtcgggccgcgcgaggagatagaacagcac
ccgtttttgcaacgcatcggccctgacgtgttggacatgtcgctgacggtagacgatgtg
gcggagcggttgctgacgccgcgttttcgccgcaggcagctgggcggcatgctgctcgac
caggcgtttctcgccggattgggcaattatctgcgcgccgaaatcctgtggcaggccgaa
ctggcgccgcagcacaaaccgcaggatctgacgccagaggcgctgcgccacctggcggag
gcattgctggcagtgccgcgcctctcctaccagacgcgtgggcaggcggatgacaaccgt
catcacggcgcgctgtttcgcttcaaggtatttcatcgcagcggcgagccctgcgaacgc
tgtggtgggatgatcgtgcgcaccgagctgtcgtcgcggccgttttattggtgcccgggc
tgccagaaatag

DBGET integrated database retrieval system