KEGG   Serratia ureilytica: J0X03_18450
Entry
J0X03_18450       CDS       T07185                                 
Symbol
recR
Name
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_18450 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_18450 (recR)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     J0X03_18450 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      J0X03_18450 (recR)
SSDB
Motif
Pfam: Toprim_4 RecR Toprim FYVE_2 HHH_5 DZR_2 HHH
Other DBs
NCBI-ProteinID: QSR06386
LinkDB
Position
complement(3912381..3912986)
AA seq 201 aa
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEQRLEKESITEVILATNPTVEGEATANYIAEMCGQYGVLASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHAIKF
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcaaaccagcccgctccttgaatccctgatggaggcgctgcgctgcctgccgggcgtc
ggcccgaaatcggcgcagcgcatggcgtttcagctgctgcagcgcgatcgcagcggcggc
atgcgtctggcgcaggcgttgacgcgcgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggacgtctgcaccatctgcgccaatccgcgccgccagcaaaac
ggccagatttgcgtggtggaaagcccggcggatatccacgccatcgagcagaccggccag
ttcgccgggcgctactttgtgctgatggggcatctgtcgccgctggacggcatcgggccg
ggcgatatcggtctggatcgcctggagcaacggctggaaaaggaaagcatcaccgaagtg
atcctcgccaccaacccgacggtggaaggggaggcgaccgccaactacatcgccgagatg
tgtggccagtatggcgtgctcgccagccgcatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcgcattcgctggcggggcgccacgccatcaag
ttctga

DBGET integrated database retrieval system