KEGG   Serratia ureilytica: J0X03_19890
Entry
J0X03_19890       CDS       T07185                                 
Symbol
recA
Name
(GenBank) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_19890 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_19890 (recA)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_19890 (recA)
    RecFOR pathway proteins
     J0X03_19890 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    J0X03_19890 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase AAA_24 ATPase_2 AAA_25 AAA_16 AAA_35 CbiA PAXNEB MobB AAA_14 AAA CobU TK AAA_22
Other DBs
NCBI-ProteinID: QSR06647
LinkDB
Position
complement(4187779..4188843)
AA seq 354 aa
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQP
DTGEQALEICDALTRSGAVDVIIVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKNANTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAIKEGDEVVG
SETRVKVVKNKIAAPFKQAEFQIMYGEGINSRGELVDLGVKHKMIEKAGAWYSYNGEKIG
QGKANACNFLKENPAIAAELDKKLRDLLLHSGGELVAASGDDFEDDEAETSEQF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctattgatgagaacaagcaaaaggcgttagctgcggcactgggccagattgagaaa
cagttcggcaaaggctccatcatgcgcctgggtgaagaccgctccatggacgtggaaacc
atctccaccggctcactgtcactcgatatcgctctgggcgccggcggcctgccgatgggc
cgcatcgtcgaaatctacggcccggaatcgtccggtaaaaccaccctgacgctgcaggtg
atcgccgccgcgcagcgcgaaggcaaaacctgtgcgttcatcgatgccgagcacgcgctg
gatcctatctatgcgaagaagctgggcgtcgatatcgacaacctgctgtgctcccagccg
gacaccggcgagcaggctctggaaatctgtgatgcgctgacccgttccggcgcggttgac
gtcatcatcgtcgattccgtggcggcgttgacgccgaaggcggaaatcgaaggtgaaatc
ggcgattcgcacatggggttggcggcgcgcatgatgagccaggcgatgcgtaagctggcc
ggcaacctgaaaaatgccaataccctgctgatcttcatcaaccagatccgtatgaaaatt
ggtgtgatgttcggcaacccggaaaccactaccggtggtaacgctctgaagttctatgct
tcggtgcgtctggatatccgtcgtatcggcgccatcaaagagggcgacgaagtggtgggc
agcgaaacccgcgtgaaagtggtgaaaaacaaaatcgctgcgccgttcaaacaggctgag
ttccaaatcatgtacggcgaaggcatcaacagccgtggcgagctggtcgatctgggcgtg
aagcacaagatgatcgaaaaagccggcgcctggtacagctataacggcgagaagatcggt
cagggcaaggcgaacgcctgtaacttcctgaaagaaaacccggctatcgccgccgagctg
gataagaaactgcgcgacctgctgctgcacagcggcggtgagctggtggctgcctccggt
gacgacttcgaagatgacgaagcggaaaccagcgagcagttttaa

DBGET integrated database retrieval system