KEGG   Serratia ureilytica: J0X03_22035
Entry
J0X03_22035       CDS       T07185                                 
Symbol
priB
Name
(GenBank) primosomal replication protein N
  KO
K02686  primosomal replication protein N
Organism
suri  Serratia ureilytica
Pathway
suri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    J0X03_22035 (priB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_22035 (priB)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     J0X03_22035 (priB)
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2
Other DBs
NCBI-ProteinID: QSR07047
LinkDB
Position
complement(4651839..4652156)
AA seq 105 aa
MTANRLVLSGTVCKAPVRKVSPSGIPHCQFVLEHRSQQMEAGFSRQAWCRMPVVVSGQQS
QALTQRLTVGSQITVQGFVSCHQGRNGLSKLVLHAEQIELIDSGD
NT seq 318 nt   +upstreamnt  +downstreamnt
gtgacggctaatcgtctggttttgtcgggcactgtgtgcaaggcgccggttcgaaaagtg
agtccttccgggataccgcactgccaatttgtgctagagcaccgttcgcagcagatggaa
gccggattcagcagacaagcatggtgccgaatgcccgtggttgtcagcggacaacagtca
caagcactaactcaaagattaacggtcggcagtcagattaccgtgcaaggctttgtaagc
tgccatcaagggcgcaacgggctgagcaaattggttctgcatgccgagcagattgaattg
atagattctggagactag

DBGET integrated database retrieval system