KEGG   Serratia ureilytica: J0X03_22135
Entry
J0X03_22135       CDS       T07185                                 
Symbol
mutL
Name
(GenBank) DNA mismatch repair endonuclease MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
suri  Serratia ureilytica
Pathway
suri03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:suri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    J0X03_22135 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suri03400]
    J0X03_22135 (mutL)
DNA repair and recombination proteins [BR:suri03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     J0X03_22135 (mutL)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c DUF6470
Other DBs
NCBI-ProteinID: QSR07067
LinkDB
Position
complement(4668386..4670269)
AA seq 627 aa
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNG
CGIGKDDLALALARHATSKISTLDDLEAIVSLGFRGEALASISSVSRLTLTSRTADQSEA
WQAYAEGREQAVTVKPAAHPVGSTLEVLDLFYNTPARRKFMRTEKTEFGHIDEVVRRIAL
ARFDVAINLSHNGKLIRQYRAAKEESQHERRLGSICGPAFLQHALNIDWQHGDLSIRGWV
ADPDGARQLGEMQYCYVNSRMMRDRLINHAIRQAYQDQLKDDQQPAYVLYLEVDPHQVDV
NVHPAKHEVRFHQARLVHDFIYQAVTTVLQQAGQTPSLPLAETPDEAPAPVWQQENRVAA
GGNHFSQPAPRRETPPPAGAARERAPQPGWQTAGGYQKREGELYGKLMRPAAEPQAEAAP
EAPSRPPLFPPVKAAVETPLASGQHSFGRVLMIHPPCYALIEQCQQPALLNLTVAERWLR
QAQLNPPTEGLRPQPLLIPVKLTLDKNEAAAIARHQALLTMMGLDLQTDHGRVTLRAVPL
PLRQQNLQKLIPELLGYLAEHQEMSPAVLATWLARRLGSEHEQWNTSQAIQLLTDVERLC
PQLVKSPPSGLLQPVDLQAALAALKHD
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgcctatccaggtgttaccgccacagctcgccaaccagatcgccgccggagaggtggtc
gaacgccccgcgtcggtcgtcaaagagctggtggaaaacagcctggacgccggtgcgacg
cgcatcgatatcgatatcgaacgcggcggcgccaagttgatccgcattcgcgacaacggc
tgcggcatcggcaaggacgatctggcgctggcgctggcgcggcacgccaccagtaaaatc
agcacgctcgacgacctggaggctatcgtcagcctcggttttcgcggcgaagcgctggcc
agcatcagctcggtttcccgtttgaccctgacgtcgcgcaccgcagaccagagcgaagcg
tggcaagcctatgccgaagggcgcgaacaggcggtgacggtcaaacccgctgcgcacccg
gtcggcagcacgctggaagtgctggatctgttttacaacaccccggcgcgccgcaagttc
atgcgcaccgagaaaaccgaattcggccatatcgatgaagtggtgcggcgcatcgcgctg
gcgcgcttcgatgtggcgatcaacctcagccataacggcaaactgatccgccaatatcgg
gcggcgaaggaagaaagccagcacgagcgccgtttgggcagcatctgcggcccggcgttt
ttgcagcatgcgctgaacatcgactggcagcatggcgatctgagcatccgcggttgggtg
gcggatccggacggggcgcgccagctgggtgagatgcagtattgctacgtcaacagccgc
atgatgcgcgatcgcttgatcaaccacgccattcgtcaggcctatcaggatcagttgaaa
gacgatcagcagcccgcttacgtgttgtatctggaggtggatccgcaccaggtggacgtc
aacgttcatcccgccaagcacgaggtgcgtttccatcaggcgcggctggtgcacgatttt
atctaccaggcggtgaccacggtgctgcaacaggccgggcagacgccgtcgctgccgctg
gcggaaacgcctgacgaggcgcctgcgccggtctggcagcaggaaaaccgcgtcgccgcc
ggcggcaaccatttttcacagccggcgccgcgtcgcgaaacgccgccaccggccggcgct
gcccgcgagcgcgcgccgcagcccggttggcaaacggcgggcggttaccagaaacgcgaa
ggcgagctgtacggcaaactgatgcggcctgccgccgagccgcaggccgaggccgcgccg
gaagccccgagtcggccgccgctgttcccaccggtgaaagccgccgtggaaacgccgttg
gcgagcgggcaacacagctttggccgggtgctgatgatccatccgccgtgctacgcactg
attgaacagtgccagcagccggcgttgctcaacctgacggtggccgagcgctggctgcgc
caggcgcagctcaatccgccgacggaagggctgcggccgcagccgctgctgatcccagtc
aagctgacgttggacaagaacgaagcggcggccatcgcgcggcatcaggcgctgctgacg
atgatggggctggacttgcagacggatcacggccgtgtgacgctgcgcgcagtgccttta
ccattacgccaacaaaatttacaaaaactgatacccgaactgttaggctatctggccgag
catcaggagatgtcgcccgcggtgttggccacctggctcgctcgccgtctcggcagcgaa
catgaacagtggaacacctcgcaagcgatacaattgctgaccgacgttgaacgactttgc
ccgcagctggtcaaatcgccaccgagcggacttttacaacccgttgatttacaggccgca
ctggcggccctcaagcatgactga

DBGET integrated database retrieval system