KEGG   Suttonella sp. R2A3: L0B52_04010
Entry
L0B52_04010       CDS       T07824                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
sutr  Suttonella sp. R2A3
Pathway
sutr00541  O-Antigen nucleotide sugar biosynthesis
sutr01100  Metabolic pathways
sutr01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:sutr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    L0B52_04010
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: UJF25319
LinkDB
Position
complement(849061..849696)
AA seq 211 aa
MLRKNILPLAGKPLVAWTIEAALESKHISKVVVTSDNAEVLDIAKTYLVTALQRPDHLAT
DTATSFDAVKHAIDNNQGYEYVVMLQPTSPLRNAKHIDEAIELLESKNSDAVISVCETEH
SPLWTNTLPASFSMDNFLRDEVYSQRSQDLPVYYRLNGALYICRISSLLKQKSFFIKNNI
FAYKMDMHSSVDIDTEMDFKWVEFLFNDIRG
NT seq 636 nt   +upstreamnt  +downstreamnt
ttgctaaggaaaaacatcttacctttagcaggaaaacctttggttgcatggactattgag
gctgcgttagaaagtaaacatatatctaaagttgtggtaacaagtgacaacgctgaagtg
ttagatattgcaaaaacctatttagtaacagcgctacaaagaccagaccatttagcaaca
gatacagcaaccagctttgatgctgtgaagcatgccatagacaacaatcaaggctatgaa
tatgtggtgatgttacaaccgacaagtccattacgtaacgcaaagcatattgatgaagct
attgaattattggaatcgaaaaattctgatgctgttatatcggtatgtgaaacagagcac
agccccttatggaccaatacgcttccagctagtttcagtatggataattttttgcgtgat
gaagtttatagtcaacgcagtcaagatctacccgtgtactataggcttaatggcgctctt
tatatttgtaggatatctagtcttttaaaacaaaaatcattctttattaaaaataatatt
tttgcctataaaatggatatgcatagctcggttgacatagatacggagatggattttaag
tgggtggagtttttatttaatgatatacgaggttaa

DBGET integrated database retrieval system