KEGG   Streptomyces viridifaciens: CP971_33680
Entry
CP971_33680       CDS       T06960                                 
Name
(GenBank) asparagine synthase
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
svr  Streptomyces viridifaciens
Pathway
svr00331  Clavulanic acid biosynthesis
svr01100  Metabolic pathways
svr01110  Biosynthesis of secondary metabolites
Module
svr_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:svr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    CP971_33680
Enzymes [BR:svr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     CP971_33680
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase QueC
Other DBs
NCBI-ProteinID: QEV03504
LinkDB
Position
complement(7580311..7581882)
AA seq 523 aa
MASTLPAATGFLAAVQCDGGRSPGAFPAPRGADPAAPGAVFASAGPRAVIKARPGGPGLD
AVLLHSGAPDAAHAHRRGRTVLLAGELYNRDELLTLLGAQAGPVTDADLLLALVDTYDLH
AFRLLNGRFAAVVADGGRVLLATDHAGSVPLYVSAVPGTVLAATEAKALRTAPVGRRITA
ARRVRRLPGTHQVPAGTVLEIGVATADCTDHRTWAPTPARRIMAEQEATEAVRLALDRAV
RARTGPDTPLVVLSGGIDSSSVAALTAHHRTGPVDTVSMGTDLADEFPQARVVAEHLGSA
HRELTVHTDDLLRRLPHAVWAAESLDPDIIEYLLPLTALYLRLEGPGRRILTGYGADIPL
GGMHRENRLPALDTALAHDMATFDGLNEMTPVLSGIAGHWSTHPFWDREVLDLLVSLESG
LKRRHGRDKWVLRAAMTDLLPHETVTRPKLGVHEGSGTTSSFSRLLTDAGVPGDRVHRAK
ELVVQHLFDRVVVDGRHPDEVATADVVQLVADALEHDALPAHP
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcgtcgacactgcccgccgccaccgggttcctggccgccgtccagtgcgacggcggc
aggtcccccggggcgttccccgccccccggggagcggaccccgccgcccccggggcggtg
ttcgcctccgccggcccgcgcgccgtcatcaaggcccgaccgggcggaccgggcctggac
gccgtcctgctgcactccggcgcacccgacgccgcccacgcccaccggcggggccgcacg
gtgctgctcgccggggagctctacaaccgggacgagctgctcaccctgctcggcgcgcag
gccgggccggtcaccgacgcggacctgctgctcgccctcgtcgacacctacgacctgcac
gcgttccggctgctcaacgggcggttcgcggccgtggtcgcggacggcggccgggtgctg
ctggccaccgaccacgccggctccgtgccgctgtacgtgagcgccgtccccgggaccgtc
ctcgcggcgaccgaggcgaaggccctgcggaccgcgccggtcggccggcggatcacggcc
gcgcgccgggtccgccggctgcccggcacccaccaggtgcccgccgggaccgtcctggag
atcggggtggccaccgcggactgcaccgaccaccgcacctgggcgcccacgccggcccgc
cggatcatggccgaacaggaggccaccgaggccgttcggctcgccctggaccgcgccgtc
cgcgcccgcaccggcccggacaccccgctggtggtgctctccggcggcatcgactcctcc
agcgtcgccgcactgaccgcccaccaccggaccgggcccgtcgacaccgtgtcgatgggc
accgacctcgccgacgagttcccgcaggccagggtggtcgccgaacacctcggctccgcc
caccgggagctgaccgtccacaccgacgacctgctgcgccggctcccgcacgcggtctgg
gccgccgagtcactcgacccggacatcatcgagtacctgttgccgctgaccgccctgtac
ctgcgcctggagggccccgggcggcgcatcctcaccggctacggcgccgacatcccgctc
ggcggcatgcaccgggagaaccggctcccggccctggacaccgccctcgcccacgacatg
gccaccttcgacggcctgaacgagatgacgccggtgctgtccgggatcgccgggcactgg
tcgacccacccgttctgggaccgcgaggtgctggacctgctggtgtcgctggagtccggg
ctcaagcggcgccacggccgggacaagtgggtgctccgcgcggccatgacggacctgctc
ccgcacgagaccgtcacccgccccaagctcggcgtgcacgagggctcgggcaccaccagc
tcgttcagccggctgctgaccgacgccggggtgcccggggaccgggtgcaccgggccaag
gagctcgtcgtccaacacctgttcgaccgggtcgtcgtcgacggccggcaccccgacgag
gtggccaccgccgacgtggtgcagctggtcgccgacgccttggagcacgacgcactgccg
gcccacccgtga

DBGET integrated database retrieval system