Shewanella woodyi: Swoo_4597 Help Entry Swoo_4597         CDS       T00676                                  Name (GenBank) phosphopantetheine-binding   KO K02078   acyl carrier protein Organism swd  Shewanella woodyi Pathway swd01100   Metabolic pathways swd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:swd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Swoo_4597   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Swoo_4597 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Prenyltransf Motif Other DBs NCBI-ProteinID:  ACA88847 UniProt:  B1KLW7 LinkDB All DBs Position 5569886..5570128 Genome browser AA seq 80 aa AA seqDB search MQSREQILEALTQILVDEFEIDAEDITPEASLYQELDLDSIDAVDLVIKLQQMTGKKIKP EEFKAVRTVDDVVTAIEGLV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaacaaattcttgaagccctaacgcagatcttggtcgatgagtttgag atcgatgctgaggatataactccagaagcttcactctaccaagagcttgatctcgacagc atagatgcggtcgatttagtgataaaactacagcagatgacaggtaaaaaaattaaacct gaagagtttaaagccgttcgtacagtggatgacgttgtcacagcgattgaagggctagta taa

DBGET integrated database retrieval system