KEGG   Rhizorhabdus wittichii RW1: Swit_4895
Entry
Swit_4895         CDS       T00538                                 
Name
(GenBank) alpha/beta hydrolase fold
  KO
K22717  2-hydroxy-6-oxo-6-(2-hydroxyphenoxy)-hexa-2,4-dienoate hydrolase [EC:3.7.1.-]
Organism
swi  Rhizorhabdus wittichii RW1
Pathway
swi00621  Dioxin degradation
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
swi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Swit_4895
Enzymes [BR:swi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.-
     Swit_4895
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_11 Abhydrolase_4 Esterase FSH1 Lipase_2 DUF3141
Other DBs
NCBI-ProteinID: ABQ71517
UniProt: A5VGV8
LinkDB
Position
pSWIT02:complement(9537..10385)
AA seq 282 aa
MRIEMTQLPSNFIATCGYRTHYIEMGEGKPLILIHGGGAGADARGNWEKLCMPLLAKDRR
VIALDMVGFGYSDAPDPEGFDYGLECRVDQLIAFIEAMNLVEATGPVDIIGNSMGGRTTL
ATAIRRPDLVGDMVLMGSAGVDRSMGGGVAPLTEYDFTYAGMERVVAALTNDHYIPDPDM
VRYRLELSQRPAYAKALSATFKALVARSGLWIEDEKIAEVQHRTLVVNGKADKVVPPEHA
YKFLSLLTNSTGVILPHCGHWAMIEHPVAFAHITSAFFARKF
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgaggatagaaatgacccagctacccagcaatttcatcgcaacttgtggataccgcacg
cattacatcgagatgggtgagggcaagccactgatccttatccacggcggcggtgctggc
gcggacgcccgcggaaactgggaaaaattgtgcatgccactactggcaaaggaccgcagg
gtaatagccctcgatatggtcggttttggctatagcgatgcacccgatccggaaggattc
gattatggtctggagtgtcgcgttgatcagctaatcgcctttatcgaggccatgaatctg
gtcgaagcaaccggtcccgtggatatcatcggcaattccatgggcgggcgcaccacactg
gctaccgccatacgccgccccgacctcgtcggtgacatggtcctgatgggtagcgctggg
gtcgaccgctcgatgggcggcggggttgcgccgctgacagaatacgacttcacttacgcc
ggcatggaacgtgtcgtcgcagcgttgaccaatgatcactacattccggacccagacatg
gtgcgatacaggctcgaactgtcacagcggcctgcctatgccaaggccctcagcgctacc
ttcaaggcgcttgtagcgcgatccggcctgtggatcgaggatgagaaaattgccgaggtc
cagcaccggacccttgtggttaacgggaaggctgacaaggttgtcccacccgaacacgcc
tataaattcctctctctcctaaccaattcaaccggcgtcatactcccccactgcgggcac
tgggcaatgatcgagcatccggttgcatttgctcatattacttcagcctttttcgctcgg
aaattctag

DBGET integrated database retrieval system