KEGG   Streptomyces xanthii: IAG42_36830
Entry
IAG42_36830       CDS       T07861                                 
Name
(GenBank) aromatase/cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sxn  Streptomyces xanthii
Pathway
sxn01056  Biosynthesis of type II polyketide backbone
sxn01100  Metabolic pathways
sxn01110  Biosynthesis of secondary metabolites
Module
sxn_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sxn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    IAG42_36830
Enzymes [BR:sxn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     IAG42_36830
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc DUF2505
Other DBs
NCBI-ProteinID: QNS09312
UniProt: A0A7H1BKQ7
LinkDB
Position
unnamed1:complement(296256..297218)
AA seq 320 aa
MSNEETGGRVHRTVHEVEADAPADVVYGIVADTARWPLFFPPNVHVEQLESDGTTERLRM
WATANGQVKSWASRRVLDPSARRIDFRQEVSAAPVESMGGSWIVTELGPERSRLTLLHDF
TVVGDDPADVEWVERATDSNSRKELENLRTLVSGWRALEGLVLSFEDSVRIDGPAERVYA
FLEQAGKWPERVAHVDRLELTEDEPGVQVMAMDTRTADGSVHTTESVRVCFPEDRRIVYK
QTETPALMAAHTGRWTVVPAEGGGVVATSHHSVVLREEPIERVLGEGADVARARGYVREA
LGRNSTATLNLAKAFAESAA
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtcgaacgaggagacgggcgggcgggtgcaccgcaccgttcacgaggtggaggccgac
gccccggccgacgtggtgtacgggatcgtcgcggacaccgcccggtggccgctgttcttc
ccgccgaacgtgcatgtggagcagctggagtccgacggcacgaccgagcggctgcggatg
tgggcgacggccaacgggcaggtgaagtcgtgggcttcgcgccgtgtgctggatccgtcg
gcgcggcggatcgacttccgtcaggaggtgtcggcggctccggtggagtcgatgggcggc
tcgtggatcgtgaccgagctgggtcccgagcgttcgcggctgacgctgctgcacgacttc
acggtcgtgggtgacgatccggcggacgtggagtgggtcgagcgggccacggactccaac
agccgcaaggagctggagaacctgcggactctggtgtccggctggcgtgctctggagggc
ctggtgctgtccttcgaggactccgtgcggatcgacggtcccgcggagcgggtgtacgcg
ttcctggagcaggccggcaagtggccggagcgggtggcgcacgtggaccggctcgagctg
accgaggacgagccgggcgtgcaggtgatggcgatggacacgcggaccgccgacgggtcg
gtgcacaccaccgagtcggtgcgggtgtgtttccccgaggaccggcggatcgtctacaag
cagacggagacgcccgctctgatggcggcgcacacgggccgctggacggtcgtgccggcc
gagggcggtggcgtcgtcgcgacgtcgcaccacagtgtggtgctgcgcgaggagccgatc
gagcgggtgctgggcgagggtgcggacgtggcgcgggcgcgtggttacgtgcgcgaggcg
ctgggccgcaacagcacggcgacgctgaacctggccaaggcgttcgcggagagcgcggcg
tag

DBGET integrated database retrieval system