KEGG   Triticum aestivum (bread wheat): 123085450
Entry
123085450         CDS       T07757                                 
Name
(RefSeq) indole-2-monooxygenase-like
  KO
K13223  indole-2-monooxygenase [EC:1.14.14.153]
Organism
taes  Triticum aestivum (bread wheat)
Pathway
taes00402  Benzoxazinoid biosynthesis
taes00999  Biosynthesis of various plant secondary metabolites
taes01100  Metabolic pathways
taes01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:taes00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00402 Benzoxazinoid biosynthesis
    123085450
   00999 Biosynthesis of various plant secondary metabolites
    123085450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:taes00199]
    123085450
Enzymes [BR:taes01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.153  indole-2-monooxygenase
     123085450
Cytochrome P450 [BR:taes00199]
 Cytochrome P450, plant type
  CYP71 family
   123085450
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 123085450
NCBI-ProteinID: XP_044363023
LinkDB
Position
4A:108313515..108315518
AA seq 528 aa
MAHVHVDELLHEAAAAAPRSLLIASAVLFSLVVVPLLLRIISKQGAASDAKLLSLLPSPP
TKLPIIGHLHLMGDLPYVSLAGLAAKYGPELMLVHLGAVPTAVVSSPRTAEAVLRTHDHI
FASRPRSMVFDIIMYGQTDSCFAPYGEHFRKARKLVTVHMLNARKIRSQRPARVEEVRLV
IGKIAKAAAAREAVDMSELLHSYVNDLVCRAVSGKFSQEEGRNKLFRELTDINAALLGGF
NILDYFPSLGRFELVCKMACAKARRVRKRWDLLLDKLIDDHAARMVSREDEAQPAQEEDK
DFIDVSLSLQQEYGLTRDHIKAILIDMFEAGTDTSYMTLEFAMAELIRKPHLMKKLQEEV
RRNVPNGQEMVAEDDLPNMTYLKAVIKETLRLHPPVPLMIPHFSLDACTVDGYTIPANTR
VVINAWALGRHSSYWENENEFQPERFMNGAGVDLKPNEFHYLPFGFGRRMCPGVHSASAT
VETMLANLMYRFDWKLPPGLKEEDIDMTEVFGITVSRKEKLILVPVTA
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggctcacgtacatgtagacgagctgctccacgaagcagcagcggcagctccacgatct
ctcttgatcgcgagtgcggtgctcttctcccttgtggttgtgccgctcctactccgcatt
attagcaagcagggagcggcaagcgatgccaagctgctgagcctgctcccatctcccccg
acgaagctccccatcatcgggcacctgcacctaatgggcgatctcccctacgtctccctc
gccggcctggccgccaagtacggcccggaactcatgctggtacacctcggtgccgtgccc
accgccgtcgtgtcctcgccgcgcactgccgaggccgtcctgcgcacccacgaccacatc
ttcgcgtcacggccgcggtcgatggtcttcgacatcatcatgtacgggcagacggactcg
tgcttcgcgccctacggcgagcacttccggaaggccaggaagctggtgacggtgcacatg
ctcaacgccaggaagatacggtcccagcgcccggcccgggtggaggaggtccggctagtg
attggaaagatcgccaaggccgcggccgcgcgcgaggccgtggacatgagcgagctcctg
cactcgtacgtcaacgacctcgtttgccgtgctgtgtcgggcaagttctcccaggaggag
gggcggaacaagctgttccgtgagctcaccgacatcaacgcggcgctcctgggagggttc
aacatcctcgactacttcccgagcctggggaggttcgagttggtctgcaagatggcctgc
gccaaggcccgacgggtgaggaagcggtgggacctgctcctcgacaagctaattgacgac
catgcagcaaggatggtaagccgtgaggatgaggcccagccggcgcaagaggaagacaaa
gacttcatcgacgtatccctatctcttcagcaggagtatggtctcaccagggaccatatc
aaggccatcttgatagacatgtttgaggccggcacggacacctcgtatatgacgctggag
tttgccatggcggagctcatacggaagccacaccttatgaagaagctgcaggaagaggta
aggaggaatgtaccaaacgggcaagagatggtcgccgaagacgatctccccaacatgacc
tacctcaaggctgtcatcaaggagacactccggctgcacccgccggtacctctcatgatt
ccacacttctccctagacgcctgcaccgttgatggctacacgatcccagcaaacactcgt
gtcgttatcaacgcctgggcactcggcaggcacagtagctactgggaaaatgaaaatgaa
ttccaacctgagagatttatgaatggagccggcgttgatctgaagccaaatgagttccat
tacttgccatttgggtttggacgtagaatgtgccctggggttcactcggcatcagcaacg
gtcgagacaatgctggcaaacctcatgtaccgtttcgattggaagcttccacccggattg
aaggaagaggacatagatatgactgaagtgtttggaataacagtttcaagaaaggaaaag
ctcatcttagtccccgtgaccgcatga

DBGET integrated database retrieval system