KEGG   Thermobifida alba: FOF52_07505
Entry
FOF52_07505       CDS       T08159                                 
Name
(GenBank) cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
talx  Thermobifida alba
Pathway
talx01056  Biosynthesis of type II polyketide backbone
talx01100  Metabolic pathways
talx01110  Biosynthesis of secondary metabolites
Module
talx_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:talx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    FOF52_07505
Enzymes [BR:talx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     FOF52_07505
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: UPT20824
LinkDB
Position
complement(1708001..1708948)
AA seq 315 aa
MNRPETKRTRHRIEVSAPAERVYALIAAVEDWAWVFGPTIHVDREDLGAGRERIHIWATA
NGDPKGWTSLRELDPTERTVRFRQEVSRPPVASMRGQWRVEPGGDGCLVVLEHEFQAVDG
DAAAEAWITRAIRTNSGAELAALKERAETPVREAGLLLEFSDEVHVEGDPADVYDFLHEA
GEWEARLPHVARVALEEDTVNIQRLEMDTRAADGGVHTTESVRVCFPRHRIVYKQLRTPE
LLAVHTGCWEVAQAGSGALVTSFHTVVLAPDAVPRVLGPGADIEKARSAVRDALGRNSRA
TMERAGAYAQKRACR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaacagacctgagacgaagcggaccaggcatcggatcgaggtgtcggcccccgccgag
cgcgtctacgcgctcatcgccgcggtggaggactgggcctgggtcttcggccccaccatc
cacgtcgaccgcgaggacctgggggcgggccgggagcggatccacatctgggccacggcc
aacggcgaccccaaggggtggacctcactgcgggaactggatcccacggagcgcacggtc
cgcttccggcaggaggtgtcccgtccgcccgtggcttccatgcgcggacagtggcgcgtg
gagcccgggggcgacgggtgcctcgtcgttctggagcacgagttccaggctgtggacggc
gacgccgcggccgaagcgtggatcacccgggcgattcgcaccaacagcggcgcggagttg
gccgcgttgaaggagagggccgagaccccggtgcgggaggccggactgctcctggagttc
tccgacgaggtccacgtcgagggggacccggccgacgtctacgacttcctgcacgaagcc
ggggagtgggaggcacggctgccccatgtcgcccgcgtcgcgctcgaggaggacacggtc
aacatccagagactggagatggacacccgtgccgccgacggcggagtccacaccaccgag
tcggtccgagtgtgctttccccggcaccggatcgtctacaagcagctccgtactcctgaa
ctgctggcggtccacacgggatgctgggaggtcgcacaagccgggagcggagctttggtc
acctccttccacaccgtcgtcctcgccccggacgcggtgccgcgggtgctgggtccgggc
gccgacatcgagaaggcccggtcggccgtgcgtgacgcgctcggccgcaacagcagggcg
acgatggagcgcgccggggcctacgcgcagaagcgggcgtgtcgctga

DBGET integrated database retrieval system