KEGG   Candidatus Thiothrix anitrata: J8380_09280
Entry
J8380_09280       CDS       T07878                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
tani  Candidatus Thiothrix anitrata
Pathway
tani00541  O-Antigen nucleotide sugar biosynthesis
tani01100  Metabolic pathways
tani01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:tani00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    J8380_09280
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: QTR48504
LinkDB
Position
complement(1774934..1775635)
AA seq 233 aa
MKILALIPARGGSKRLPRKNILPLGGKPLIVWSIDIAKDIPEICDILVSTDDPEIAETAK
EAGALVPWLRPHELATDTATSVDVALHALDWYENTHGSVDGILLLQPTSPFRTKQTIVSG
IEKYITSNKKSIIGVSPVHHHPSWMLKLNKDNLLEKFIEDESNGINTRSQDLPPAFSING
SFYLTPPANIRKNKTFFGKETFPLITNNILEILDIDTEADLIMATCLIQKYVN
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaaaatacttgccttaatcccggcacgtggtggctctaaacgactaccaaggaaaaat
attcttccacttggtggaaaaccgctcattgtatggtcaatagatattgccaaagatatt
ccagaaatctgtgacattttggtttcaactgatgatcctgaaattgctgaaactgctaaa
gaagcaggagcattagtgccttggttacgcccacatgaactggctacagatacggcaact
tctgtagatgtagccttacatgctctggattggtatgagaatactcacggaagtgttgac
gggatacttttattgcagcctacatcaccgtttcgtactaaacaaaccattgttagtggt
attgaaaaatacattacctctaataaaaagagtattattggagtatcaccagtacaccat
catccgtcgtggatgttaaaacttaacaaagataatttactagaaaaattcattgaagat
gaaagtaatgggataaatacccgatcacaagatttaccaccagcattttcgattaatggt
tctttttatttaacaccccctgcaaatatcagaaaaaataaaactttttttggcaaggaa
acatttcccttaataacaaataatatattggaaattttagatatcgatacagaagctgat
ttaatcatggcaacatgtcttattcaaaaatatgttaattaa

DBGET integrated database retrieval system