KEGG   Trichosporon asahii var. asahii: A1Q1_06821
Entry
A1Q1_06821        CDS       T06566                                 
Name
(RefSeq) hypothetical protein
  KO
K21820  unspecific peroxygenase [EC:1.11.2.1]
Organism
tasa  Trichosporon asahii var. asahii
Brite
KEGG Orthology (KO) [BR:tasa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A1Q1_06821
Enzymes [BR:tasa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.1  unspecific peroxygenase
     A1Q1_06821
SSDB
Motif
Pfam: Peroxidase_2 T4_tail_cap
Other DBs
NCBI-GeneID: 25990333
NCBI-ProteinID: XP_014182545
UniProt: J6F9L8
LinkDB
Position
Unknown
AA seq 418 aa
MLSSVQLVLLATSVSAYPWVADAVEGRPLDERSLSGFWDTLRLGAKDISQSLGGVLKAQN
DGKMKALGGEIKKGVDWIYAQANATEGFEGWPKPSLLDKSAADLSQELIYQTYNLDRVSN
PPIWPIADEGHPYVAPGPGDVRGPCPGLNTLANHGYLPHNGIVSPDQLVRAVWEALSMSP
DLGAILTVAGFVFKGDIDTMKLSIGGQVRGAGVGLSQHGTIEGDGSVTREDSALGDHVKV
SQQRLQTYYGEIAKYGTNGYDINPTVCAESRYRAYQDSVQNNPAVDFSSTRHLIAYAESG
FAMEVFRGANVSCTAETIDWFFNKEQFPPGWRRRNTPVTATEMIAWGMLFNKIKPTEPVR
GLGIKGHPVKAGSSFLSEGTVKSNIEKFSGGLIKAVPKAMKYMAEALGQSGPLAGLDG
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgctctcctccgttcaacttgttctcctcgctacctccgtctcggcctacccctgggtg
gccgatgcggtcgagggacgccccctcgatgagcgcagcctgtccggcttctgggacacg
cttcgtcttggtgccaaggacatcagccagtccctcggcggcgtgctcaaggcccaaaac
gacggcaagatgaaggcgctcggcggcgagatcaagaagggtgtcgactggatctacgcg
caggccaacgccaccgagggcttcgagggctggcccaagccgtcgctcctcgacaagagc
gctgccgacctctcccaggagctcatctatcagacatacaatctcgaccgtgtcagcaac
ccgcccatctggcccatcgccgacgagggtcacccgtacgtcgcccccggtcccggcgat
gttcgtggcccatgccccggcctcaacaccctcgccaaccacggctacctccctcacaac
ggtattgtttcccccgaccagctcgttcgtgctgtctgggaagctctctcgatgagcccc
gaccttggtgccatcctgaccgtcgccggattcgtcttcaagggcgacatcgacaccatg
aagctctctatcggcggccaggtccgcggtgccggtgtcggtctctcccagcacggtacg
atcgagggcgacggaagcgtcacgcgcgaggactctgccctcggagaccatgtcaaggtg
tctcagcagcgtctgcagacctattacggcgagatcgccaagtacggcaccaatggatac
gacatcaaccccaccgtctgcgctgagtctcgctaccgtgcttaccaggactcggtccag
aacaaccccgccgtcgacttctcgtccactcgccacttgatcgcctatgctgagagcggt
ttcgccatggaggtcttccgtggcgccaacgtgtcgtgcaccgccgagacgatcgactgg
ttcttcaacaaggagcagttcccgcccggatggcgccgccgcaacactcccgtcacggct
actgagatgatcgcgtggggcatgctgttcaacaagatcaagccgaccgagcccgtccgc
ggcctcggcatcaagggccaccctgtcaaggccggatcttccttcctctctgagggcacc
gtcaagtccaacattgagaagttctctggtggcctcatcaaggccgtccccaaggctatg
aagtacatggctgaggcgttgggacagtctggtcccctcgctggccttgacggttag

DBGET integrated database retrieval system