Tolumonas auensis: Tola_2385 Help Entry Tola_2385         CDS       T00904                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism tau  Tolumonas auensis Pathway tau02024   Quorum sensing tau03018   RNA degradation Brite KEGG Orthology (KO) [BR:tau00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Tola_2385  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Tola_2385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tau03019]     Tola_2385    03036 Chromosome and associated proteins [BR:tau03036]     Tola_2385 Messenger RNA biogenesis [BR:tau03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Tola_2385 Chromosome and associated proteins [BR:tau03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Tola_2385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ACQ93982 UniProt:  C4L9M9 LinkDB All DBs Position complement(2611561..2611818) Genome browser AA seq 85 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQVESFDQFVILLKNTVSQMVYKHAIS TVVPARPVAHHTAPAAGDSDSQSEE NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatccttacaagatccatttttgaatgcgttacgtcgtgagcgtatt cctgtatctatctatctggtcaatggtattaagctgcaaggacaggtcgaatcattcgat caatttgttattttgctgaaaaacacagtcagtcagatggtttataagcacgcaatctct accgtggttcctgctcgtccggtagcgcatcacactgcacccgctgctggtgacagtgat tcacagtctgaagagtaa

DBGET integrated database retrieval system