KEGG   Tetrapisispora blattae: TBLA_0C01710
Entry
TBLA_0C01710      CDS       T02489                                 
Symbol
TBLA0C01710
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
tbl  Tetrapisispora blattae
Pathway
tbl04111  Cell cycle - yeast
tbl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tbl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TBLA_0C01710 (TBLA0C01710)
   04113 Meiosis - yeast
    TBLA_0C01710 (TBLA0C01710)
SSDB
Motif
Pfam: CDT1 CDT1_C
Other DBs
NCBI-GeneID: 14494965
NCBI-ProteinID: XP_004179504
UniProt: I2H0T3
LinkDB
Position
3:404280..406175
AA seq 631 aa
MASKIPTLDLDVIANSGTDLSLVMKDLLTQYDTILLKNFANKDQLDVLLYNLDNIDIPDT
EQGFDANFTGTIPLANGDPNQNHDESVLIEQYIFNTDENLNFGRPCDNKSLSHLYARLFK
LGLYFSQICFNAMVLQSNEIEFNEKKFSAMITRFYTPHVYRQISDTKHLTNEMIDMEDDD
EQDELNILTTGDHFNYLHSEDFIDFNSTGIITIFPRATGIKYKPATSSMSDNIWISIEEP
DCVLIHTGVLLAKWSNGLHQTSPLKLATHRNVIHCTIAPPLNTKLSGNDGEHHTISNLLL
DQQMIQLPQVAKQFYSRDLDILKLEENIRFYKELFNVSETVLSLYMMSRSTKNNPPEIQN
LLPQISNMLKKKIDEEMFLKLLTIWPECYIVEANIRFELSIRLPKVDPLHALTTKSRKLE
FIEHADIWLEEAKNMKNIPKDIPATHISKRRSSQNLQASKLLHNSQTINEEDAEVMKFSP
KKLTNNKTNYISNSSSKYINTEKNFDSQSNLLQRLREKEKKSTELLLQRENNYKLFLTSK
MTQIFEIMFLLDWNQPYTETHLNSLIVDSLRDSNNPIGEVEVNEILLKIHEFLPNKFQMY
STDGGLKVYRWDNLDKDEFQLKLAAYKKSFT
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcttccaagattcctacactggatttagatgtcattgcaaacagtggtacagatctt
tcattagttatgaaagatctattgacccaatatgataccattttacttaaaaatttcgca
aataaggatcaattggatgtcttactatataatttagacaatattgatattcctgataca
gaacaaggattcgatgctaatttcactggtactattccgctagcaaatggagatcctaat
caaaatcatgatgaaagtgttttaatagagcaatatattttcaatactgacgagaattta
aatttcggtagaccttgtgataataaatcattaagtcatttatatgctagattatttaag
ctagggctatatttttcgcagatttgttttaatgcaatggtattgcaatcaaacgaaatt
gaatttaatgaaaaaaaattttctgcaatgataacaagattttatacccctcatgtttat
cgacaaatttcggacactaagcatttaacaaatgagatgattgatatggaagatgatgac
gaacaagatgaactcaatatattgactactggggaccatttcaattatttacattcggag
gattttatagatttcaattctaccggtatcattactatttttccaagagcaacaggtatt
aaatacaagccagcaacttcctcgatgagtgataatatctggatttctattgaggaacca
gattgtgtattaatccatacaggagttctattagccaaatggtctaatggattacatcaa
acatctcctttaaaattagcgactcatagaaacgttattcattgtacgattgcacctcca
ttgaatacaaaattatctggcaatgatggtgagcatcatactatttcgaatcttttatta
gatcagcaaatgatacaattacctcaagtagcaaagcaattttatagtcgagatttagat
attctaaaattggaagaaaacattcgtttttacaaagaattatttaatgtatcagaaact
gttctttcattatacatgatgtcaagatcaacaaagaataatcctccagaaattcaaaat
ttactaccacaaattagtaacatgttgaagaaaaagattgatgaagaaatgttcttaaaa
ttactaacaatttggccggaatgttatattgttgaagcaaatattaggtttgaactgtca
attagattaccaaaagttgatccattgcatgcattaactacaaaatcaagaaaattagag
ttcattgagcatgctgatatatggctagaagaggcaaaaaatatgaaaaatatccctaag
gatatcccagcaacacacatctctaaaagacgttctagtcaaaatttacaagcatctaaa
ttattacataattcacaaacaattaatgaagaagatgctgaagtgatgaaattttcacca
aaaaagcttacaaataacaaaacaaattatatatcgaattcaagtagtaaatatattaat
acagagaagaatttcgattctcagagtaatttattacaaaggttgagggaaaaggagaaa
aaatcaaccgaattattattgcagagagaaaacaattataaattatttttgacaagtaaa
atgactcaaatttttgaaataatgttcttattggattggaatcaaccatatacagaaaca
catttaaattcactaattgtcgatagtttacgtgatagtaataatccaattggtgaagtt
gaggtgaatgaaattttacttaagattcatgaattcttaccaaataaatttcaaatgtat
tctaccgatggaggtttaaaagtttatagatgggataatcttgataaagatgaattccaa
ttaaagttagcagcttataaaaaatcatttacgtaa

DBGET integrated database retrieval system