KEGG   Tribolium castaneum (red flour beetle): 656884
Entry
656884            CDS       T01046                                 
Symbol
CYP306A1
Name
(RefSeq) cytochrome P450 306A1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    656884 (CYP306A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tca00199]
    656884 (CYP306A1)
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     656884 (CYP306A1)
Cytochrome P450 [BR:tca00199]
 Cytochrome P450, animal type
  CYP306 family
   656884 (CYP306A1)
SSDB
Motif
Pfam: p450 DUF22
Other DBs
NCBI-GeneID: 656884
NCBI-ProteinID: XP_968477
LinkDB
Position
LG9:complement(1624713..1727515)
AA seq 481 aa
MAPLWSVLLSFLLFIIAYTWLRRSRNLPPGPWNLPVIGYLAWLNPQFPYLTLTSLSKKYG
PIYGLYLGSIYTVVISDAKLIKKTFNKDASSGRAPLHLTHGIMKGFGLICAQGDLWKDQR
KFVHNTLRTLGASKVSPNRPTMEALILHHVSDLVQHIKSLGESVTLDPLDSLRHSLGSAI
NQMVFGKCWSRDDATWKWLQHLQEEGTKHIGVAGPLNFLPLLRFLPKSKQTINFLTEGIR
DTHQIYREIIEEQKNSSNETVSNVIQAFLAEKEKRKNEDSVKFYNDQQFHYLLADIFGAS
LDTTLTTLRWYVLYMAVHQDVQKKVRSLLNDLTLEQIAMVPYFEATIAEVQRIRPVVPVG
IPHGSVEELEIAQYKVPPGTMIVPLQWAVHMDANIWDEPEVFKPERFINEEGKFFKPEAF
IPFQAGKRMCVGDELARMFLYLFGAALVKNFAISCMGEVDLTGDCGITLTPKPHELIFTS
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctccgctgtggtcagtgctcttatcgtttctcctgttcatcatcgcgtacacctgg
ctccgtcgctctcgtaacttgcctccaggtccttggaacctacctgtgatcggttatttg
gcctggttgaaccctcagtttccttacctgactctaacttctctctctaaaaagtacggt
cccatctacggcctctatctgggcagtatctacaccgtggtgatctccgacgccaaactc
atcaagaaaaccttcaacaaagacgcatcctcaggccgtgcgcccttgcacctgacccat
ggcataatgaagggtttcggcctgatttgcgcacaaggcgacttatggaaagatcaacgc
aaattcgtccacaacaccttacgaactcttggtgcttccaaagtgagtccaaaccgaccc
accatggaagccctaatcctgcaccacgtctcagaccttgtccaacacattaaaagcctc
ggtgaatccgtcactctggaccctcttgactcgctccgccatagccttggctcggccatc
aaccaaatggtgttcggtaagtgttggtcacgagacgatgccacttggaagtggctgcaa
catcttcaggaagaggggacgaaacacattggggttgccgggcctttgaattttttgccg
cttttaaggtttttgccaaagtcaaaacaaacaataaatttcttaaccgagggaatccga
gacacccaccaaatatatcgcgaaataatcgaagagcaaaaaaattcgtctaacgaaact
gttagtaatgtcatccaagcgtttcttgctgagaaagagaaacgaaaaaatgaagacagt
gttaagttctacaacgaccaacaatttcattacttgttggctgatattttcggggccagt
ttggacacgactttgaccacgttacggtggtacgtgctgtacatggcagtgcaccaagac
gtccagaaaaaagtgcgatcacttttaaatgatctaacacttgaacaaatcgcaatggtg
ccatattttgaagcaactattgctgaagttcagagaattcgaccggtcgtacctgtgggt
attccacacggaagtgtggaagagctggaaattgctcagtataaggttccaccaggtacc
atgatagtaccattacaatgggcagttcatatggatgcgaatatttgggacgaacctgaa
gtgttcaaacctgaacggtttatcaacgaagaagggaagtttttcaaaccggaagctttt
attccgtttcaagcgggtaaaagaatgtgtgtcggtgatgaattggctcgaatgttcctc
tacctctttggtgcagctttggtaaaaaatttcgccatcagttgtatgggagaagttgat
ttgactggagattgtggcattacactaactccgaaacctcacgaattgatttttacaagt
ttgtaa

DBGET integrated database retrieval system