Thermococcus celer: A3L02_04740 Help Entry A3L02_04740       CDS       T05076                                  Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism tce  Thermococcus celer Pathway tce00400   Phenylalanine, tyrosine and tryptophan biosynthesis tce01100   Metabolic pathways tce01110   Biosynthesis of secondary metabolites tce01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:tce00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     A3L02_04740 Enzymes [BR:tce01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      A3L02_04740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 YabA DUF3375 Med11 Osmo_CC DUF2680 LpxI_N HSBP1 Lge1 YscO KIF9 FlgN PMC2NT SKA2 FlaC_arch NYD-SP28 Motif Other DBs NCBI-ProteinID:  ASI98915 UniProt:  A0A218P1W4 LinkDB All DBs Position 865754..865984 Genome browser AA seq 76 aa AA seqDB search MERIHELRKEIDEIDKQIAELLEERVRVVTEIGKIKRELGLPIRDEKREEELLKRAGRFK EVFEKILEACRDVQRV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt ttggaaaggattcatgagcttaggaaagagatagatgagattgataaacaaatagccgag ctcttggaggagagggtcagggttgtcacggagattgggaaaataaagagggagctgggt ttgcccataagggatgagaaaagagaggaggaattactcaagagagccggcagatttaaa gaggttttcgagaagatactggaggcttgcagggatgttcaacgtgtatga

DBGET integrated database retrieval system