Thermococcus celer: A3L02_04780 Help Entry A3L02_04780       CDS       T05076                                  Name (GenBank) hypothetical protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism tce  Thermococcus celer Pathway tce00290   Valine, leucine and isoleucine biosynthesis tce00650   Butanoate metabolism tce00770   Pantothenate and CoA biosynthesis tce01100   Metabolic pathways tce01110   Biosynthesis of secondary metabolites tce01210   2-Oxocarboxylic acid metabolism tce01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:tce00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     A3L02_04780    00660 C5-Branched dibasic acid metabolism     A3L02_04780   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     A3L02_04780   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     A3L02_04780 Enzymes [BR:tce01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      A3L02_04780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT ACT_4 ACT_7 ACT_6 Motif Other DBs NCBI-ProteinID:  ASI99927 UniProt:  A0A218P4S2 LinkDB All DBs Position 872162..872569 Genome browser AA seq 135 aa AA seqDB search MRHYEIVRIRETGKVEIPRDYAYELGIVEGAYFLLEMDTDLNEVHMERIALPGKKLVEAE LIVEDKPGVLAKISGLFGRHGVNILFSEAEELEGIGLAGIAAVIDVSGLKGTLEELKGEL EGLNVVREVTLRPLE NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgaggcactatgagatagtcaggataagagagactggaaaggttgaaataccgagggat tacgcctacgagctcggtatcgtggaaggtgcatacttcctcctggagatggacaccgac ctcaacgaggtccacatggagcgcatagcccttccgggaaagaagctcgtcgaagccgag ctgatagttgaggacaaacccggtgtccttgcaaaaataagcgggctcttcggaagacat ggggtgaacatacttttcagcgaggccgaggagcttgagggcatagggctggctggaata gctgcggtcatagatgtgagtggactgaagggcacccttgaggaacttaaaggggagctt gaggggctgaacgtcgtgagggaggttaccctaagaccactggagtag

DBGET integrated database retrieval system