KEGG   Thermococcus chitonophagus: CHITON_0626
Entry
CHITON_0626       CDS       T04536                                 

Definition
(GenBank) Folate biosynthesis protein PTPS-III, catalyzes a reaction that bypasses dihydroneopterin aldolase (FolB)
  KO
K22102  dihydroneopterin phosphate aldolase [EC:4.1.2.59]
Organism
tch  Thermococcus chitonophagus
Pathway
tch00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:tch00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CHITON_0626
Enzymes [BR:tch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.59  dihydroneopterin phosphate aldolase
     CHITON_0626
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: CUX77405
UniProt: A0A160VR82
LinkDB
Position
I:589664..590011
AA seq 115 aa
MKARLIVRTSFDAAHAVKIENDWEELHGHTFFLEVIVEGPIKHGYIMDFVKLRKTIESVT
KEIDHRNLNKIFDNPTTENIALWLADKIKGKLPDKVILKRLVLWEGSDYGVELEW
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaaggcaaggttgattgttagaacaagctttgacgctgctcacgcagttaaaatcgaa
aacgattgggaagaattacatggacacacatttttcttggaggttattgttgaaggacca
ataaagcatggatatataatggattttgtaaagctcagaaagacaattgagagtgtaact
aaagaaattgaccatagaaatctgaataagatatttgataacccaacaactgagaacata
gctttatggcttgcggataaaataaagggcaaattgcccgataaagttattttaaagagg
ctagttctctgggaaggaagtgactatggggtggagctagagtggtaa

DBGET integrated database retrieval system