KEGG   Torulaspora delbrueckii: TDEL_0A05490
Entry
TDEL_0A05490      CDS       T02236                                 
Symbol
TDEL0A05490
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04111  Cell cycle - yeast
tdl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TDEL_0A05490 (TDEL0A05490)
   04113 Meiosis - yeast
    TDEL_0A05490 (TDEL0A05490)
SSDB
Motif
Pfam: Fungal_TACC DUF3130 DUF6247 HMMR_N
Other DBs
NCBI-GeneID: 11502899
NCBI-ProteinID: XP_003679092
UniProt: G8ZMN7
LinkDB
Position
1:962132..964477
AA seq 781 aa
MRSSSPKTNNFEMSDERGMEDPVGGLSSMPTTPVQKTPIRGSNNEEAVTSVVLMRSATRL
KVHPHGLSAKKKLEECESVQGSLEVPVVVEQWTDRSLDCVRRSEEEGKQNALERIDINRM
FSTSQENVEGVEEPMIRMNRSPLRLDMSSPIKTNTIDDEGPQPKRLKLELECVPSLPQPD
DEKDGANELVGSPEVIEMIDTKSSPMREFSHAECEEHRNEGFDGTPRRRISSLHTLTPIR
KNTDEIYNLSDGAELGEGYHMITSRNEELAKQVHVLNQKLNKMMTSCDVAFFHYKKMKAD
YETLSVDCEQKLNKSYEEVLALIKERDRFKERAYKLKTRIDESTDEFHMLKQNQSILQGK
YETLINESETSKQRETELGVECSSLKGEVARCSKERQLLDEELKNVSTQLHDVTTRNTML
EDHNEKLREEISDLKERLTTKNGELERLQKQLDETISAGKGANDEVLAELNEVIAQRANL
EAELEALRVASEADGNKLRDQLHEAVTRSNLMVLEVQELKDHSDGLQAGLNARVSEIEQM
SKKIEELNDDAEIGKAEIKELQEDKLELERTNACLESSIAELEDSVRNWQAKYHEQEEKD
KISLELESIQLKNNNIEAEHLAELEQLHSNLSSLQDALKENSDVITDLKNLNEKLREDNK
AFEKKYQEALKNESRESDLRLVEALKKEVIAWKEKYQLKEQESNKSLKLLAEDLYIQYSS
KHEQKVKLLKKGYETKFQSKLDKITLQNEGLTQEIDLLKNQLASERKEKQKLLEVLESRK
S
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgagatcaagtagtccgaaaacaaacaactttgagatgtctgatgagcgtggtatggag
gatccagtggggggtcttagcagcatgccgactaccccagttcaaaagacacccatacgg
ggttctaataatgaagaggccgtgactagtgtggttctaatgcggtctgctacacggttg
aaagtacatccgcatggattgtcagcgaagaagaagctagaagagtgtgagtctgttcag
gggtctcttgaggtaccggtggttgtcgagcagtggacggataggtcgttggactgcgtt
aggaggagtgaagaggaggggaagcagaacgcgttagagagaattgatatcaatcgaatg
ttctcgacgagtcaggaaaatgtcgaaggtgtggaagagcctatgattcgtatgaaccgc
tcgcctttgaggcttgatatgagctcgccgatcaagacaaatacgattgatgacgaaggt
ccacaaccaaagagactgaaactggaattagaatgtgtaccaagtttgccacaaccagat
gatgagaaggatggcgctaatgagcttgttggctcacctgaggttattgagatgatagat
acgaagagcagtccaatgagggagtttagtcacgctgaatgtgaggaacatagaaacgaa
gggtttgatggaactcctagacgacgtatctccagtttgcatactttaactcctatacgc
aagaacactgatgagatatataatctttcggacggtgctgaattaggtgaaggatatcat
atgattactagtcgaaatgaagagttggccaaacaagtccacgtactaaatcagaagtta
aataagatgatgacaagttgtgatgtcgcttttttccattacaagaaaatgaaggctgat
tacgagaccctgtcagtagactgtgaacagaaattgaataagagctatgaagaagtgcta
gcgttaataaaggaacgggacaggtttaaagaaagggcctacaagttaaaaacccgcata
gatgagtcaaccgatgagttccatatgctcaagcagaatcaatctattctacaaggtaaa
tatgaaacgcttatcaacgagtctgaaactagcaagcaaagggaaaccgagctgggtgtt
gagtgctcttccctgaagggagaggtagcgagatgttcaaaagaacgtcagcttttggat
gaagagctgaagaatgtttcgactcaactgcatgatgttactactcgcaatactatgctt
gaagatcataacgaaaagttaagggaagagatatctgacttaaaagaaagactcacaact
aaaaatggcgagttagaaaggttgcaaaagcagctagatgaaacgataagtgccggaaaa
ggggcaaatgatgaagtattggcagaactcaacgaagtgatagcccagagagcaaatcta
gaagctgaactcgaggctttaagagtagcttccgaagctgacgggaacaagctgagagat
caattacatgaagcggtaacgcgttcaaacttgatggttttagaagtacaggagcttaag
gatcattccgatgggctccaggcaggactgaatgcaagagtatctgaaattgagcaaatg
agtaaaaaaattgaagaactcaatgatgatgcagaaattgggaaagcagagataaaggag
ttgcaagaggataaactagagttagaacgtacaaatgcgtgtttggagagttctatcgca
gaattagaagacagtgtgagaaactggcaggcaaagtaccacgaacaagaggagaaagat
aagatttcgctcgaactcgaaagcatacagttaaaaaataacaatattgaggcagaacat
ttagcagagttagagcaattgcatagtaatttgagctctcttcaagatgctttgaaggaa
aattcagacgttatcactgatctgaaaaatctaaatgaaaagctgagagaagataataaa
gcttttgaaaaaaaatatcaggaggctctgaagaatgaatctagagaatctgatctccga
ctcgttgaagcattaaaaaaagaagtgatagcatggaaagaaaagtatcagttgaaggag
caagaatcgaacaaatcattgaaacttcttgccgaagatctctacattcagtactcatca
aaacatgaacaaaaagtgaaattactgaaaaagggctacgagacgaagtttcagagcaag
ctagacaagattacactgcaaaatgaaggtctcacacaggaaattgatttattgaaaaat
caattggcatctgagaggaaggagaagcaaaagctgcttgaggtgcttgagtcaaggaaa
agttag

DBGET integrated database retrieval system