KEGG   Torulaspora delbrueckii: TDEL_0C01430
Entry
TDEL_0C01430      CDS       T02236                                 
Symbol
TDEL0C01430
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04111  Cell cycle - yeast
tdl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TDEL_0C01430 (TDEL0C01430)
   04113 Meiosis - yeast
    TDEL_0C01430 (TDEL0C01430)
SSDB
Motif
Pfam: CDT1_C CDT1
Other DBs
NCBI-GeneID: 11500367
NCBI-ProteinID: XP_003680243
UniProt: G8ZR90
LinkDB
Position
3:244093..245847
AA seq 584 aa
MSAGYRLPVVDLDLISDEQALLPEVERIIRRNDTFLLKNYANKGLLDGLMDILQHEDVPD
VEEGFDANFTGVLELQDDILLEQYIFNTDQTLKFDRECTNESLRKLYVRLFKVGLFFLQL
CMKSVGAPELVTEKDYSSIFSRYYRQDSTTQVLPNGETFEYVLNRAFRDFVCPGILTIFP
VARGIKIKPPTVSADDNTWMTIDEPDCLLIHTGTLLAQYSGGVCSSSRIQISPESNAVYL
TLAPPLAAVIDSTGKTVAEGLLKQQILELPEVAKKFYPREAALMQITKMIGFYKELFSIT
ETVLSLYAMSRTSFSAPKLDSLLPQISNMMRKKISQQDFLKMIFLWPECYVLEADSRGDL
TVKLPRRENLLISKSRRLEFVEKADKWLNGVSGMAKIPTDVPVLRSSKRRGSGGSDPEPT
QLMKARSPTNAVPPSSNYISNSKDKFMYAEKKTDSQSNLLERLRERERRSAALLSQRQRQ
YDQFLAVKMKQVFEILYSLPQSKPYTATHLSSLIVDSLQDSNNPIGTEEAVMILDKLQTL
LGAQLIAQTVDGGLKVYRWNSLDKGLVLARIEDALDQSMHIDHL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgagtgctggttatagactgccagtggtggatcttgacctgatcagtgatgagcaggct
cttttacccgaagttgaaaggattattcgtcgtaatgatacgttcttactgaaaaactat
gccaacaagggcctactggatggattgatggatattttgcagcatgaggatgttccggat
gtagaggagggttttgatgcgaatttcacgggagttttagaattgcaagatgatatttta
cttgaacagtacatcttcaatacggatcagactttaaaattcgatagagagtgcaccaac
gagtctttgagaaaattgtatgtgagattgttcaaagtgggtctttttttcttacaactg
tgtatgaaaagtgttggagcaccggaattggtgactgagaaagattattcttcgatattt
agtcgatactacaggcaggactcaactacacaggttttgcccaatggagagaccttcgaa
tatgttttgaatagggctttcagggattttgtgtgccctggtattctcacaatattccct
gtggcccgaggcattaagataaaacctccaacagtgagtgccgatgataatacttggatg
actattgatgagcctgactgtcttctgattcatacaggtactttactggcacagtactcg
ggcggggtttgttccagttcaaggatacaaatttcaccagaaagcaatgctgtatatctt
accctagcacctccattagcagcagtgatcgactctaccggtaaaactgttgcagagggt
ctgttgaagcaacaaatccttgagcttcccgaagtggctaagaaattttatccaagagag
gcagccttaatgcagatcacaaaaatgattggtttctacaaagagcttttctctatcact
gaaacggtgttgtcactgtacgcaatgtcaagaacatcattctctgccccaaagttggac
tcattacttcctcaaatttccaatatgatgcgaaagaagatttctcaacaagatttcttg
aagatgatattcttatggccagagtgttacgtgctggaggctgattccaggggcgatttg
actgtcaaactgccgagaagagagaacttgctcataagtaagtctaggcgcctagagttt
gtcgagaaggcagataaatggctaaacggcgtaagtggaatggccaagataccgaccgat
gttcctgttctaagatcttcgaagagacgaggtagtggaggctctgatccagaaccaact
caattgatgaaagcgaggagcccgacgaatgccgtgcccccatcatccaattatatctct
aactctaaagataaattcatgtacgccgagaagaaaacggattctcagagtaacctatta
gaaagattgagggagagggaaagaaggtcagctgctctactctctcaacgtcagaggcag
tatgatcaatttctggcagtgaagatgaaacaggtcttcgaaatcttatactctctgccg
cagagcaaaccttacaccgctactcatttgagctcattgatcgtagacagcctacaggat
agtaataaccccattggaaccgaagaggcagtgatgattctggacaaactacaaactctg
ttaggcgcccagttgatagcccaaacagtagatggtggtttaaaagtctacaggtggaac
agtcttgataaaggcttagtattagcaagaattgaagatgctctcgaccaatccatgcat
attgatcatttgtga

DBGET integrated database retrieval system