KEGG   Torulaspora delbrueckii: TDEL_0G01460
Entry
TDEL_0G01460      CDS       T02236                                 
Symbol
TDEL0G01460
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04111  Cell cycle - yeast
tdl04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    TDEL_0G01460 (TDEL0G01460)
   04113 Meiosis - yeast
    TDEL_0G01460 (TDEL0G01460)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tdl03400]
    TDEL_0G01460 (TDEL0G01460)
DNA repair and recombination proteins [BR:tdl03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    TDEL_0G01460 (TDEL0G01460)
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 11504571
NCBI-ProteinID: XP_003682724
UniProt: G8ZYN8
LinkDB
Position
7:293610..295280
AA seq 556 aa
MSFRAVISDPERQQLWFRTINVLATIYKDIRLTITPTEIIAWNLNSTDTTLCKVRFSSQF
FEEYDFKPREIVFGASGVQTINDSHRRDHKLYSLQINGRHLTTISRKPDGDAIKNFTIAI
NNTSTCPDTLTNRLLVHVEMESLISKEYTPQFEPIKYDPIIIDLKYKRNFLDVYGSASAS
STGHEEALDPKLVDIFTATRNELSNALFNDQPENNARNEDKLTVADEINYMCCNQALLKN
FIDDCNANVTEEFKLEISVHKLVITAFTKAIYGKNNDILRNTMSLSNTISVNDLEHYCLF
TTTDDTSDTAVQKKDQTKAIIFKLKDLKNFLSIGSTWKTTQSENLNIWFCRGGDPILIEL
KKNGVTLELVQVTDSNGSNITVEDHLARTVIKKAISPKKRKTQAANEDLASSRISPLRNQ
KSTAENRRSPLKEHLDATLAENQPRKLFVTDDSQETTTHRQWGRSDSNWTDDDLVSREPT
EPAEEPTNPAPVRAERTGTTIEWGTRSLEPEENFSTLDRKSVLKREKLKHFKALTESEEP
EGLGPTQISKPKGLFD
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtcattcagggccgtcatttctgatcctgagagacaacagctttggtttcgtaccatt
aatgttctagccaccatctacaaagatatacggctaactataacaccgacagagataata
gcatggaatttaaacagcacggatacaacgctatgcaaagtacgattctcctcgcaattc
tttgaagagtatgactttaaacctagagagattgtatttggtgcaagtggtgtccagacg
ataaatgactcccatcgaagagatcacaagctatactctttgcagatcaatggtcgacat
ttgaccacaatttcacgaaagccagacggcgatgcgatcaagaacttcacgatagccatt
aataacacttcaacatgtcctgatacattaaccaaccggctactggtacatgttgaaatg
gagtcacttataagcaaagaatatacaccgcagttcgagcccataaagtatgatcctatt
ataatcgatcttaagtacaagaggaactttttggatgtttatgggtctgctagtgcttcg
tcaactggtcatgaagaggcattagaccctaaactagtggatatctttactgcgacaagg
aatgagctatctaatgcacttttcaatgatcaaccagaaaataatgcgagaaacgaggat
aaactgacagttgctgatgagatcaactacatgtgttgcaaccaggcgctgctgaagaat
ttcatcgacgattgcaacgccaatgttacagaagagtttaaactggaaattagtgtccat
aaattagtcatcactgcattcactaaggccatttatggcaaaaataacgatattctgaga
aatacaatgagtctaagcaacaccataagcgtcaacgatctcgaacattactgtcttttc
actacaaccgacgacacgtccgatacagcggtacagaaaaaggatcagacaaaagctatt
atcttcaagctgaaggatctcaagaattttctgagcattggatcgacatggaaaactact
caaagtgagaaccttaacatatggttctgccgcggcggggacccaatactgatagagttg
aaaaagaatggagtaactttggagttggttcaagtgacagacagtaatggctctaatata
actgttgaggaccacttggcgagaactgttatcaagaaggctatatctccaaaaaagaga
aagacgcaagctgctaatgaggaccttgcatcgtcgcgtataagtccgctgaggaaccag
aaatctaccgcggaaaatcgaagaagtcctctgaaggagcacctggatgccacactagca
gaaaaccagccaaggaaactttttgttactgatgactcgcaggagactacaacacacagg
caatggggccgttctgattccaattggactgatgacgatctggtaagtcgagagcctacc
gaaccagcagaagagcctacaaatcctgcacctgttcgtgctgagaggacgggtaccacg
attgaatggggaacgaggtctttggaaccagaagaaaacttctcgacacttgatagaaag
agtgttttaaagagagagaagttgaagcatttcaaagctttgactgaatccgaggaacct
gaggggctgggaccgacacagatttcaaaaccgaagggtttattcgactga

DBGET integrated database retrieval system