KEGG   Trachypithecus francoisi (Francois's langur): 117072035
Entry
117072035         CDS       T07225                                 
Name
(RefSeq) cytochrome P450 3A5 isoform X1
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
tfn  Trachypithecus francoisi (Francois's langur)
Pathway
tfn00140  Steroid hormone biosynthesis
tfn00830  Retinol metabolism
tfn00980  Metabolism of xenobiotics by cytochrome P450
tfn00982  Drug metabolism - cytochrome P450
tfn01100  Metabolic pathways
tfn05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:tfn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    117072035
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    117072035
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    117072035
   00982 Drug metabolism - cytochrome P450
    117072035
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    117072035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tfn00199]
    117072035
Enzymes [BR:tfn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     117072035
Cytochrome P450 [BR:tfn00199]
 Cytochrome P450, animal type
  CYP3 family
   117072035
SSDB
Motif
Pfam: p450 Coa1 DUF1796
Other DBs
NCBI-GeneID: 117072035
NCBI-ProteinID: XP_033047759
LinkDB
Position
Unknown
AA seq 503 aa
MDLIPNLAVETWLLLAVSLVLLYLYGTRSHGLFKRQGIPGPTPLPFLGNILSYRQGIWKF
DTECHKKYGKMWRTQDGPVPVLTITDPDMIKTVLVKECYSVFTNRRPLGPVGLMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKSKPVTLKDIFGAYG
MDVITSTSFGVNIDSLNNPKDPFVESVKKFLKFGFSDPLFASIILFPFLIPAFEALNVSL
FPKDAMNFLNKSVNRMKKSRLNDKQKHRVDFLQLMIDSQNSKETESHEALSDQELVAQSI
IFIFAGYETTSSVLSFTIYELATHPDVQQKLQEEIDAVLPNKAPATYDAVVQMEYLDMVV
NETLRLFPIGMRLERVCKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFS
KKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLAIIKVLQNFSFKPCKETQIPLKLGNQ
GLLQSEKPIVLKVESRDGTLSGE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatatgggacccgttcacatggactttttaagagacagggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctatcgtcagggtatctggaaattt
gacacagaatgtcataaaaagtacggaaaaatgtggagaacgcaagatggtccggtccct
gtgctgaccatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggcctttaggtccagtgggacttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtgttggtgagaaacttg
aggcgggaagcagagaaaagcaagcctgtcaccttgaaagacatctttggggcctacggc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccaaaa
gacccctttgtggaaagcgttaagaagttcctaaaatttggcttctcagatccattattt
gcctcaataatactctttccattccttatcccagcttttgaagcattaaatgtctctctg
tttccaaaagatgccatgaattttttaaataaatctgtaaacagaatgaaaaaaagtcgc
ctcaacgacaaacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacgaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcactatatatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagattgatgcggttttgccc
aataaggcacctgccacctacgatgccgtggtacagatggagtaccttgacatggtggtg
aatgagacactgagattattcccaattggtatgagacttgagagggtctgcaagaaagat
gttgaaatcaatggggtgttcattcccaaaggggcaatggtggtgattccaacctatgct
cttcaccatgacccaaaatactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaacaaggacagcatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcaaagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggcaaccaa
ggccttcttcaatcagaaaaacccattgttctaaaggttgagtcaagagatggaacccta
agtggagaatga

DBGET integrated database retrieval system