KEGG   Trachypithecus francoisi (Francois's langur): 117087704
Entry
117087704         CDS       T07225                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
tfn  Trachypithecus francoisi (Francois's langur)
Pathway
tfn04610  Complement and coagulation cascades
tfn04810  Regulation of actin cytoskeleton
tfn05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:tfn00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117087704 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117087704 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    117087704 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:tfn04515]
    117087704 (ITGAX)
   04090 CD molecules [BR:tfn04090]
    117087704 (ITGAX)
Cell adhesion molecules [BR:tfn04515]
 Integrins
  Integrin alpha subunits
   117087704 (ITGAX)
CD molecules [BR:tfn04090]
 Proteins
  117087704 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 117087704
NCBI-ProteinID: XP_033074130
LinkDB
Position
Unknown
AA seq 1154 aa
MTRTKAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQERTAA
NQTGSLYQCSYSTGACEPIGLQVPPEAVNMSLGLSLAATTSPPQLLACGPTVHHGCGRNM
YLTGLCFLLAPTQLTQRLPASRQECPRQELDIVFLIDGSGSISPGNFATMMNFVRAVISQ
FQRPSTQFSLMQFSSEFYVHFTFEKFRRTSNPLGLLASVHQLRGFTHTATAIQKVVRQLF
QASHGARGDATKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGSAFQNTNSWKE
LNDIASKPSQEHIFKVEDFDALKNIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPILGAVGSFTWSGGAFLYPPNMNPTFINMSQENVDMRDSYLGYSTELALWKGVQNL
VLGAPRYQHTGKAAVFTQVSGQWRLKAEVTGTQIGSYFGASLCSVDVDGDGSTDLILIGA
PHYYEQTRGGQVSVCPLPRGWSRWWCDAVLHGEQGHPWGRFGAALTVLGDVNGDKLMDVV
IGAPGEEENQGAVYLFHGALGPSIGPSHSQRITGSQLSPRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFKPAEIPRSAFECREQVVSDQILGQSSICLYIDK
HSKNLLGSRDLQSSLRMDLALDPGRLSPRATFQETKNRSLSXVQVLGLQTYCETFTLLLP
TCVEDSVTPITLRLNFTLVGEPLSAFRNLRPMLAADAQRYFMASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVIVWNDGEDSYGTTITFSHPAGLSYRCVAESQKQGQ
LRSLRLTCDSAPAGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTNKTTFQLELPLKYAVYTVASSHEQSTKYLNFSDSEEKESRVAMHRYQVNNL
GQRDLPVSVNFWVPVELNQEAVWMEVEVSHPQNPSLRCSSEKIAPSASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSIQEELDFTLTGNLSFAWVCQTSQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYEVHNPTPIIVGSSIGGLLLLALITVALYKVGFFKRQYKEM
MEEANGQIAPENRT
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgaccaggacaaaggcagcgctcctcctgttcacagccttagcaacttctctgggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagt
gtggtccagtatgccaactcctgggtggtggttggagccccccaagagagaacagctgcc
aaccaaacgggcagcctctaccagtgcagctacagcaccggtgcctgtgagcccattggc
ctgcaggtccccccggaggccgtgaacatgtccctgggcctgtccctggcggctaccacc
agccccccccagctgctggcctgcggccccaccgtgcaccacgggtgtgggaggaacatg
tacctgactggactctgcttcctcctggcccccacccagctcacccagaggctcccggcg
tccaggcaggagtgcccaagacaggagctggacattgtgttcctgattgatggctcgggc
agcatctcccccggcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccagtgaattctacgtacac
ttcacttttgagaaattcaggcgcacctcaaaccccctcggcctgttggcttctgttcac
caactgagagggttcacacacacggccactgccatccaaaaagtcgtgcgccaattgttc
caggcctcacacggggcccgtggggatgccactaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggatcagcttttcaaaacacaaactcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaaaatattcaaaaccagctgaaggagaagatctttgccattgaaggtacggag
accacaagcagtagctccttcgaattggagatggcgcaggagggcttcagcgctgtgttc
acgcctgatggccccattctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtatcccccaaatatgaaccccaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggctctctggaaaggggtgcagaacctg
gtcctgggggccccccgctaccagcacactgggaaggctgccgtcttcacccaggtgtcc
gggcaatggaggctgaaggccgaagtcacggggacacagattggttcctacttcggggcc
tccctctgctccgtggatgtggacggcgatggcagcactgacctgatcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagcaggtggtggtgtgatgctgttctccacggggagcagggccatccctggggtcgc
tttggggcggctctgacagtgctgggggacgtgaatggggacaagctgatggacgtggtc
atcggggccccaggagaggaagagaaccagggtgctgtctacctgtttcacggagccttg
ggacctagcatcggcccctcccacagccagcggatcaccggctcccagctctcccccagg
ctgcagtattttgggcaggcactgagcggcggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggacgagacctgtgctctgg
gtaggggtgagcatgcagttcaaacctgccgagatccccaggtctgcatttgagtgtcgg
gagcaggtggtctctgaccagatcctgggacagtccagcatctgcctttacattgacaaa
cattccaagaacctgcttgggagccgtgacctccaaagctctctgaggatggacctggct
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agctgagtccaagtcctcgggctgcagacatactgtgaaaccttcaccctgctgctcccg
acctgcgtggaggactctgtgacccccatcaccttgcgtctgaacttcacgctggtgggc
gagcccctctctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcatggcctctctcccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcctgaagaccctgctggtggggagtaacctggag
ctgaacgcagaagtgatagtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccacccagcaggactgtcctaccgctgtgtggcagagagccagaaacaggggcag
ctgcgttccctgcgcctgacatgtgacagcgccccagctgggagccagggcacctggagt
accagctgcagaatcaaccacctcatcttccgtggtggtgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccgactgcttctgacagccaatgtg
agcagtgagaacaacacccccaggacgaacaagaccaccttccagctggagctcccgctg
aagtatgctgtctacactgtggctagcagccacgaacaatccaccaagtacctcaacttc
tcagactctgaggagaaggagagccgtgtggccatgcacagataccaggttaataacctg
ggacagagggacctgcctgtcagcgtcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggaggtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcaccctcagcgtctgacttcctggcacacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgatgtgccctccttcagcatccag
gaggagctggatttcaccctgacgggcaacctcagtttcgcctgggtctgccagacatcg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
gaggtccacaaccccacccccatcatcgtaggcagctccattgggggtctgctgctgctg
gcgctcatcacagtagcactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacaggacatag

DBGET integrated database retrieval system