KEGG   Trachypithecus francoisi (Francois's langur): 117093301
Entry
117093301         CDS       T07225                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
tfn  Trachypithecus francoisi (Francois's langur)
Pathway
tfn04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tfn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    117093301 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:tfn04050]
    117093301 (TNFRSF8)
   04090 CD molecules [BR:tfn04090]
    117093301 (TNFRSF8)
Cytokine receptors [BR:tfn04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   117093301 (TNFRSF8)
CD molecules [BR:tfn04090]
 Proteins
  117093301 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 117093301
NCBI-ProteinID: XP_033084200
LinkDB
Position
Unknown
AA seq 595 aa
MRALLAALGLLFLGALRAFPQDRPFEDTCRGNPSHYYDKAVRRCCYRCPTGLFPTQQCPQ
RPADCRKQCDPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQPGMFCAVSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCELASPGLSPACASPENCKEPSSGTIPQAKPT
PVSPATSNGSTMPLRGGTRLAQESASKLTRAPGSPSSVGRPSSDPGLSPTQPCPQGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRVCECRPGMVCATSATNSCARC
VPYPICAAETVTKPQDMAEEDTTFEAPPLGTQPDCSPTPENGEAPASTSPTLSSLVDSQA
SKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVLAVVVGSSTFLLCHRRACRKRIQQKL
HLCYPAQTSRPKLELVDSRPRRSSMQLGSGAFVTEPSAEELGLLSRPPRETCHKEGAACP
ESLPLRDASPAGGPSSPRDLPEPRVSTEHTNNRIEKIYIMKADTVIVGTVKAELPEGQGL
VGPAEPELEEELEADHAPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgcgccctcctcgccgcgctgggactgctgttcctgggggcgctccgagccttccca
caggatcgacccttcgaggacacctgtcgtggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccacggggctgttcccgacacagcagtgcccacag
aggcctgctgactgcaggaagcagtgtgaccctgactactacctggatgaggccggccgc
tgtacagcctgcgtgagctgttctcgagacgacctcgtggagaagatgccgtgcgcatgg
aactcctcccgtgtctgcgaatgtcaacctggcatgttctgtgccgtgtctgccgtcaac
tcctgtgcccgctgcttcttccattctgtctgcccagcagggatgattgtcaagttccca
ggcacggcgcagaagaacacggtttgtgagctggcttccccagggctcagccctgcctgt
gccagcccggagaactgcaaggaaccctccagtggcaccatcccccaggccaagcccacc
ccggtgtccccagcaacctccaatggcagcaccatgcctctaagagggggcacccgcctt
gcccaggaatctgcttctaaactgacaagggctcccggctctccctcctctgtgggaagg
ccgagttcagatccaggtctgtccccaacgcagccgtgcccacaggggtctggcgactgc
aggaagcagtgtgagcctgactactacctggatgaggctggccgctgcacggcctgcgtg
agctgttctcgagacgacctcgtggagaagacgccgtgtgcatggaactcctcccgcgtc
tgcgaatgtcgacctggcatggtctgtgccacatcagccaccaactcctgtgcccgctgt
gtcccctacccaatctgtgcggcagagacagtcaccaagccccaggatatggctgaggag
gacaccacctttgaggcgccacccctggggacccagcctgactgcagccccaccccagag
aatggcgaggcgcctgccagcaccagccccactctgagctccctggtggactcccaggcc
agtaagacgctgcccatcccaaccagcgctcccatcgctctctcctccacaggtaagccc
gttctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggc
tccagcaccttcctcctgtgccaccggagggcctgcaggaagcgaattcagcagaagctc
cacctgtgctacccggcccagacctcccggcccaagctagagcttgtggattccagaccc
aggaggagctcaatgcagctcgggagtggtgcgtttgtgacagaacccagtgcggaagag
ctggggttactgagccggccaccgagggagacctgccacaaagagggggcagcctgcccg
gagagcctgccgctgcgggatgccagcccggctgggggcccctcgtcccccagggacctt
cctgagccccgggtgtccacggagcacaccaataacaggattgagaaaatctacatcatg
aaggccgacactgtgatcgtgggaactgtgaaggcggagctgccagagggccagggcctg
gtagggccagcggagcccgagttggaggaggagctggaggcggaccatgccccccactac
cccgagcaggagacagagccgcctctgggcagctgcagtgatgtcatgctgtcagtggaa
gaggaagggaaagaagacccattgcccacagctgcctctggaaagtga

DBGET integrated database retrieval system