Thermanaerosceptrum fracticalcis: BR63_07865 Help Entry BR63_07865        CDS       T06762                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism tfr  Thermanaerosceptrum fracticalcis Pathway tfr00362   Benzoate degradation tfr00621   Dioxin degradation tfr00622   Xylene degradation tfr01100   Metabolic pathways tfr01120   Microbial metabolism in diverse environments tfr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:tfr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BR63_07865    00622 Xylene degradation     BR63_07865    00621 Dioxin degradation     BR63_07865 Enzymes [BR:tfr01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BR63_07865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QNB46235 UniProt:  A0A7G6E2D1 LinkDB All DBs Position 1507538..1507726 Genome browser AA seq 62 aa AA seqDB search MPIVQIEMIGGRTIEQKRAMVKEVTEALVKTINCKRESVKIIIRDMEKHNIADGGVLKCD QS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgccaattgtgcaaattgaaatgatcggcggcaggacaattgaacaaaaaagggctatg gtaaaagaagtaacagaggctctagtgaaaaccatcaattgcaagagggaaagcgttaag attattatccgggatatggaaaaacacaacatcgccgatggtggcgtgttgaagtgtgac caatcatag

DBGET integrated database retrieval system