KEGG   Torulaspora globosa: HG536_0A01440
Entry
HG536_0A01440     CDS       T06981                                 
Name
(RefSeq) uncharacterized protein
  KO
K06663  DNA damage checkpoint protein
Organism
tgb  Torulaspora globosa
Pathway
tgb04111  Cell cycle - yeast
tgb04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tgb00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    HG536_0A01440
   04113 Meiosis - yeast
    HG536_0A01440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tgb03400]
    HG536_0A01440
DNA repair and recombination proteins [BR:tgb03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    HG536_0A01440
SSDB
Motif
Pfam: Rad9 DUF4362 Hus1
Other DBs
NCBI-GeneID: 59323424
NCBI-ProteinID: XP_037137002
LinkDB
Position
1:277544..279214
AA seq 556 aa
MSFKATISDPERHQIWSRTVNALSTIYEDVRLTITPSELIVWNINSTDTTLSKVRFSSQF
FEEYTFQPREIIFGESGIQVVTDSHGVDHKLYSLQINGRHLSTVSKKPDGDAIKNFTISI
NNSPTCPDILTNRLLVHVEMESLIRKEYTPQFQPIEYDPIIIDLKYKRNFLNVYGSASSL
PNGEMEHLDPKLQAIFNDSRKELSEALFSDDPKADSKRDNKLTAADEINFICCNQALLKN
FIDNCNANVTEEFKLEINVHKLVMTAFTKAIYGKNNDILKNTMSLSNTISVADLEHYCLF
TTVDEGESSSADGKKDQTKSIIFKLKDLKNFLSTTWSWKTAHNDNLNIWFCHSGDPILIE
LKKNGVTLQLVQVTDGSGAHFDHEDHMAGTVIKKAISPEKSKIHVTHGDTSDPRRSPLRS
HQRYTTETRTSPLNDRPTSTAAHAPRRLFVTGDSQPASQRRGSGSRLDWNDQDRLSREPT
EFAPEPTNTAPVRAERTGTTIEWGKRPREEDEDFSTLDRQSVLKNEKIKHFQAITKMQEA
EGLGPTQQTKPKGLFD
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtcattcaaggcgactatctcagacccagaaagacaccaaatttggtctcgtacggta
aatgcactttccactatctatgaggacgtaaggcttacaataacgccgagtgaattgatc
gtatggaatataaacagtacagacactacattgagcaaagtacgtttctcatctcaattt
ttcgaagagtatacgttccaaccacgagaaataatctttggtgaaagcggcatccaagtt
gtgactgactctcatggtgtagaccataagttatactcgctccagatcaacggccgacat
ctcagtaccgtctccaagaaaccagatggcgatgccatcaagaattttaccatttccatc
aataattcgcctacatgtccggatatcctgaccaatcgacttttggtgcatgttgaaatg
gaatctttgattagaaaagaatatacgccgcaattccaacctatagaatatgatccaata
attattgatctgaaatacaagaggaacttcttgaatgtgtatggatctgcaagctcactg
ccgaatggtgaaatggaacacttggatcctaagctgcaagcgatctttaatgattccaga
aaagaattatctgaggccctcttcagcgatgatccgaaagcggattctaagagagataat
aagctgacggcagctgatgaaattaattttatatgctgcaaccaagcgttactgaagaac
ttcattgacaactgcaatgcgaatgtaaccgaggaattcaagctggagatcaatgttcac
aagcttgtgatgactgcgtttacgaaggctatctatggtaaaaataatgatattctgaag
aacactatgagtctgagcaacacaatcagcgtcgcggatctcgaacactattgtttgttt
actaccgtagacgaaggtgagtcttctagcgcagatgggaagaaggatcaaacgaaatcc
ataatatttaaactgaaagatctcaaaaatttcctgagtacaacgtggagttggaaaacc
gctcataatgataacttgaacatatggttttgccatagtggtgatcctattctgatagag
ctgaaaaaaaatggcgtaacgctacagctggttcaagtaacagacggtagcggcgcacat
ttcgaccacgaagatcatatggctggaacagtgattaagaaagcaatatcccccgagaag
tccaagattcatgtcactcacggcgatacctccgatccacgtcgtagtcctctgagaagc
catcagaggtacaccaccgaaacacgaacgagccctctgaatgatcggcctacgtctact
gccgcgcatgcgcccaggcgactctttgtcaccggcgattcacagccggcttcgcagagg
agaggttctggttcgagacttgactggaacgatcaagatcgactcagccgagagcccacg
gaatttgctccagagccgactaacactgcacctgttcgtgccgaaagaacaggtactacg
attgaatggggaaaaaggccccgagaagaggatgaggacttttcaactctcgacagacag
agtgtgctcaaaaatgagaagatcaagcatttccaggcaataactaaaatgcaggaagcc
gagggactaggccccactcagcagacaaaaccgaagggtctattcgattag

DBGET integrated database retrieval system