KEGG   Theropithecus gelada (gelada): 112621194
Entry
112621194         CDS       T08041                                 
Name
(RefSeq) cytochrome P450 3A5 isoform X1
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
tge  Theropithecus gelada (gelada)
Pathway
tge00140  Steroid hormone biosynthesis
tge00830  Retinol metabolism
tge00980  Metabolism of xenobiotics by cytochrome P450
tge00982  Drug metabolism - cytochrome P450
tge01100  Metabolic pathways
tge05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:tge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    112621194
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    112621194
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112621194
   00982 Drug metabolism - cytochrome P450
    112621194
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    112621194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:tge00199]
    112621194
Enzymes [BR:tge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     112621194
Cytochrome P450 [BR:tge00199]
 Cytochrome P450, animal type
  CYP3 family
   112621194
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 112621194
NCBI-ProteinID: XP_025236305
Ensembl: ENSTGEG00000012203
LinkDB
Position
3:13571579..13616235
AA seq 503 aa
MDLIPNLDMETWLLLAVSLVLLYLYGTRSYGLFKRQGIPGPTPLPFLGNILSYRQGLWKF
DTECYKKYGKMWRTQDGQLPVLTITDPDMIKTVLVKECYSVFTNRRPFGPVGLMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITSTSFGVNIDSLNNPKDPFVESVKKFLKFDFLDPLFLLTILFPFLIPAFEALNVSL
FPKDAINFLNKSVNSMKKSRLNDKQKHRVDFLQLMIDSQNSKETESHKALSDQELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEETDAVLPNKAPATYDAMVQMEYLDMVV
NETLRLFPIAIRLERSCKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFS
KKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLAIIKVLQNFSFKPCKETQIPLKLGNQ
GLLQSEKPIVLKAESRDGTLSGE
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggacatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatacgggacccgttcatatggactttttaagagacagggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctatcgtcagggtctctggaaattt
gacacagaatgttataaaaagtatggaaaaatgtggagaacgcaagatggtcaactccct
gtgctgaccatcacagatcccgacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggccttttggtccagtgggacttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctgtctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatgtgttggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccctgaaagacatctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccaaaa
gacccctttgtggaaagcgttaagaagtttctaaaatttgatttcttagatccattattt
ctcttaacaatactctttccattccttatcccagcttttgaggcattaaatgtctctctg
tttccaaaagatgccataaattttttaaataaatctgtaaacagcatgaaaaaaagtcgc
ctcaacgacaaacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggagactgatgcagttttgccc
aataaggcacctgccacctacgatgccatggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccaattgctattagacttgagaggtcctgcaagaaagat
gttgaaatcaatggggtgttcattcccaaaggggcaatggtggtgattccaacctatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaacaaggacagcatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcaaagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggcaaccaa
ggccttcttcaatcagaaaaacccattgttctaaaggctgagtcaagagatggaacccta
agtggagaatga

DBGET integrated database retrieval system